KEGG   Isoptericola variabilis: Isova_2862Help
Entry
Isova_2862        CDS       T01520                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
iva  Isoptericola variabilis
Pathway
iva00860  Porphyrin and chlorophyll metabolism
iva01100  Metabolic pathways
iva01110  Biosynthesis of secondary metabolites
iva01120  Microbial metabolism in diverse environments
Module
iva_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:iva00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Isova_2862
Enzymes [BR:iva01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Isova_2862
Exosome [BR:iva04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Isova_2862
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: AEG45548
JGI: Isova_2862
UniProt: F6FVP7
Position
3143227..3144252
Genome map
AA seq 341 aa AA seqDB search
MSTSGIVYRPRRLRATPRMRRLVAEHRLHAADLVLPLFVKEGLTEPAPISSMPGQVQHTE
ETLRDAVAAAARAGLGGIMLFGIPAVRDATGSQAEAPDGILQRGIRAAREAIAAVEQETG
RPGPVVMADTCLDEFTDHGHCGVLTPDGVVDNDATLDRYAAMAVAQAKAGAEVVSPSGMM
DGQVAVIRDALDDAGFESVSILAYSAKYASPFYGPFREAVDSALQGDRRTYQMDAANGRE
GLREADLDLAEGADMVMVKPAGSYLDVLRGVADRSDVPVAAYQVSGEYAMIEAAAANGWI
DRRASVLESVLSIKRAGADVILTYWALEIAGWFSEGQEGRA
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
gtgagcacctccgggatcgtctaccggccgcgccgtctgcgcgccacgccgcgcatgcgc
cgcctcgtcgccgagcaccggctccacgcagccgacctggtgctgccgctgttcgtcaag
gaaggactcaccgagccggcgcccatcagctcgatgcccggccaggtgcagcacaccgag
gagacgctgcgcgacgcggtcgccgcggcagcgcgcgcgggcctcggcgggatcatgctc
ttcggcatcccggcggtgcgcgacgcgaccggctcgcaggccgaggcgcccgacgggatc
ctccagcgcggcatccgcgccgcgcgcgaggcgatcgccgccgtcgagcaggagaccggc
cggccgggaccggtcgtcatggccgacacgtgcctcgacgagttcaccgaccacgggcac
tgcggggtcctcacgccggacggcgtggtcgacaacgacgcgacgctcgaccggtacgcg
gccatggcggtcgcgcaggcgaaggccggcgcggaggtcgtctcgccgtcggggatgatg
gacggccaggtcgcggtgatccgcgacgcgctcgacgacgcgggcttcgagtcggtgagc
atcctcgcctacagcgccaagtacgcgagcccgttctacgggcccttccgcgaggcggtc
gactcggcgctgcagggcgaccggcgcacgtaccagatggacgcggccaacggccgcgag
ggcctgcgcgaggccgacctcgacctcgccgagggcgcggacatggtcatggtcaagccc
gccggctcgtacctcgacgtgctgcgcggcgtcgcggaccgctcggacgtgcccgtcgcg
gcgtaccaggtctccggcgagtacgcgatgatcgaggccgccgccgccaacggctggatc
gaccgccgggcctcggtgctcgagtccgtgctgagcatcaagcgcgcgggcgccgacgtg
atcctcacctactgggcgctcgagatcgccggctggttcagcgaaggacaggaaggacgg
gcatga

DBGET integrated database retrieval system