KEGG   Janthinobacterium sp. LM6: BZG29_00765Help
Entry
BZG29_00765       CDS       T04756                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jal  Janthinobacterium sp. LM6
Pathway
jal00071  Fatty acid degradation
jal00072  Synthesis and degradation of ketone bodies
jal00280  Valine, leucine and isoleucine degradation
jal00310  Lysine degradation
jal00362  Benzoate degradation
jal00380  Tryptophan metabolism
jal00620  Pyruvate metabolism
jal00630  Glyoxylate and dicarboxylate metabolism
jal00640  Propanoate metabolism
jal00650  Butanoate metabolism
jal00900  Terpenoid backbone biosynthesis
jal01100  Metabolic pathways
jal01110  Biosynthesis of secondary metabolites
jal01120  Microbial metabolism in diverse environments
jal01130  Biosynthesis of antibiotics
jal01200  Carbon metabolism
jal01212  Fatty acid metabolism
jal02020  Two-component system
Brite
KEGG Orthology (KO) [BR:jal00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BZG29_00765
   00630 Glyoxylate and dicarboxylate metabolism
    BZG29_00765
   00640 Propanoate metabolism
    BZG29_00765
   00650 Butanoate metabolism
    BZG29_00765
  Lipid metabolism
   00071 Fatty acid degradation
    BZG29_00765
   00072 Synthesis and degradation of ketone bodies
    BZG29_00765
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BZG29_00765
   00310 Lysine degradation
    BZG29_00765
   00380 Tryptophan metabolism
    BZG29_00765
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BZG29_00765
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BZG29_00765
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BZG29_00765
Enzymes [BR:jal01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BZG29_00765
Exosome [BR:jal04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BZG29_00765
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AQR67050
UniProt: A0A1S6F0L6
Position
188738..189934
Genome map
AA seq 398 aa AA seqDB search
MNDPVVIVGAARTPMGAFQGDFANVTASDLGAVAIRAAVERAGVAPDAVEHVFFGNCLMA
GQGQAPARQALRKAGLPDSTGAVTLSKMCGSAMQTTMFAHDTLLAGSADVVVAGGMESMT
NAPYLVPKARGGYRIGHGMIYDHMMMDGLEDAYSRDEKGNARSMGTFAEECASQYSFTRE
AQDAFAIESVKRAQAATKDGSFEWEIVPVTVSGRGGDTIVSIDEGPQKARLEKIPTLKAA
FKKDGTITAASSSSINDGAAALVLMRESTAKKLGCTVIARIHGHATHAQAPNEFTTAPIG
AVKKLYAKTGWSSSNVDLFEINEAFAAVPMAAMHDLDIPHSKINIHGGACALGHPIGASG
ARIIVTLLGALKKTGGKRGVAALCIGGGEATAMAIELV
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgaatgatccagtcgtaatcgtcggtgccgcgcgcacccccatgggcgccttccagggc
gactttgccaacgtcaccgccagcgacctgggcgccgtcgccatccgcgccgccgtggaa
cgggccggcgtggcgccggatgccgtggaacacgtgtttttcggcaattgcctgatggct
ggccagggccaggcgcccgcgcgccaagccttgcgcaaggccggcttgcccgattccacg
ggcgccgtgaccctgtcgaaaatgtgcggctcggccatgcagacgaccatgttcgcgcat
gataccttgctcgccggcagcgccgacgtggtggtggcgggcggcatggaatcgatgacc
aacgccccctacctggtgccgaaggcgcgcggcggctaccgcatcggccacggcatgatc
tatgaccacatgatgatggatggcctggaagacgcctacagccgcgatgaaaagggcaat
gcccgctcgatgggcacgttcgccgaagagtgcgccagccaatacagcttcacgcgcgaa
gcgcaggatgcgtttgccatcgaatccgtgaagcgcgcgcaagcggccaccaaggatgga
agtttcgagtgggaaatcgtgcccgtgaccgtttccggccgcggcggcgacaccatcgtc
agcatcgatgaaggcccgcaaaaggcccgcctggaaaaaatcccgacgttaaaagccgct
ttcaagaaggatggcaccatcacggccgcttcgtcttcgtcgatcaacgatggcgcggca
gccctggtgctgatgcgcgaatcgacggcgaaaaagctcggctgcaccgtcatcgcgaga
attcacggccacgccacgcacgcgcaggcgccgaacgaattcactacggctcccatcggc
gcggtgaaaaaactgtacgccaagacgggctggagcagcagcaatgtcgacttgttcgag
atcaatgaagcattcgcggccgtgccgatggccgccatgcacgacctcgacattccacac
agcaagatcaacatccacggcggcgcgtgcgcgctgggccacccgatcggcgcctcgggc
gcgcgcatcatcgtcaccctgctgggcgccctgaaaaaaaccggcggcaagcgcggcgtg
gcggccctgtgcatcggcggcggcgaagcgacggcgatggcgatcgaactggtataa

DBGET integrated database retrieval system