KEGG   Jannaschia sp. CCS1: Jann_0014Help
Entry
Jann_0014         CDS       T00330                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
jan  Jannaschia sp. CCS1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00760 Nicotinate and nicotinamide metabolism
    Jann_0014
Enzymes [BR:jan01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.19  nicotinamidase
     Jann_0014
    3.5.1.-  
     Jann_0014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13339..13932
Genome map
AA seq 197 aa AA seqDB search
MTQALLVIDVQNDFCPGGALAVTDGDTIVPGINALMAEFNAVILTQDWHPAGHSSFASSH
DAEPMSLMQMPYGPQVLWPDHCIQGSVGAQFHADLTTDRADLIIRKGYNPAIDSYSAFFE
NDHTTPTGLEGYLRTRGITDLTLVGLATDFCVNYSAVDAAKLGFTVTIRTDLCRAIDFDG
SLTNALTAMHAAGATIV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagccctacttgttatcgacgtccagaacgatttttgccccggcggcgcactg
gccgtgaccgatggggataccattgtgcccggcatcaacgcgctgatggcggagttcaat
gccgtgatcctgacccaagactggcacccggcggggcacagttctttcgcgtccagccat
gacgcagaaccgatgagcctgatgcagatgccctacggcccccaggtcctctggcccgat
cattgcatccagggcagcgtcggcgcgcagttccacgcggacctgacaaccgaccgcgcc
gatctgatcatccgcaagggctacaaccccgccatcgacagctattccgccttctttgaa
aatgatcacaccacgcccaccggccttgaagggtatttgcgcacccgggggatcaccgac
ctgacgcttgtgggcctcgccacggatttctgcgtgaactactccgccgtggatgccgcc
aagctggggttcaccgtcaccatccgcacggacctgtgccgcgcgattgattttgacggg
tcgctgacaaacgccctgaccgccatgcacgcggcaggcgcgacaatcgtctaa

DBGET integrated database retrieval system