KEGG   Jannaschia sp. CCS1: Jann_0014Help
Entry
Jann_0014         CDS       T00330                                 

Definition
nicotinamidase
Orthology
K08281  
nicotinamidase/pyrazinamidase [EC:3.5.1.19 3.5.1.-]
Organism
jan  Jannaschia sp. CCS1
Pathway
Nicotinate and nicotinamide metabolism
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Nicotinate and nicotinamide metabolism [PATH:jan00760]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
13339..13932
Genome map
AA seq 197 aa AA seqDB search
MTQALLVIDVQNDFCPGGALAVTDGDTIVPGINALMAEFNAVILTQDWHPAGHSSFASSH
DAEPMSLMQMPYGPQVLWPDHCIQGSVGAQFHADLTTDRADLIIRKGYNPAIDSYSAFFE
NDHTTPTGLEGYLRTRGITDLTLVGLATDFCVNYSAVDAAKLGFTVTIRTDLCRAIDFDG
SLTNALTAMHAAGATIV
NT seq 594 nt NT seq  +upstreamnt  +downstreamnt
atgacccaagccctacttgttatcgacgtccagaacgatttttgccccggcggcgcactg
gccgtgaccgatggggataccattgtgcccggcatcaacgcgctgatggcggagttcaat
gccgtgatcctgacccaagactggcacccggcggggcacagttctttcgcgtccagccat
gacgcagaaccgatgagcctgatgcagatgccctacggcccccaggtcctctggcccgat
cattgcatccagggcagcgtcggcgcgcagttccacgcggacctgacaaccgaccgcgcc
gatctgatcatccgcaagggctacaaccccgccatcgacagctattccgccttctttgaa
aatgatcacaccacgcccaccggccttgaagggtatttgcgcacccgggggatcaccgac
ctgacgcttgtgggcctcgccacggatttctgcgtgaactactccgccgtggatgccgcc
aagctggggttcaccgtcaccatccgcacggacctgtgccgcgcgattgattttgacggg
tcgctgacaaacgccctgaccgccatgcacgcggcaggcgcgacaatcgtctaa

DBGET integrated database retrieval system