KEGG   Jannaschia sp. CCS1: Jann_0146Help
Entry
Jann_0146         CDS       T00330                                 

Gene name
bchD
Definition
magnesium chelatase subunit D
Orthology
K03404  
magnesium chelatase subunit D [EC:6.6.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jann_0146 (bchD)
Enzymes [BR:jan01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     Jann_0146 (bchD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
136656..138347
Genome map
AA seq 563 aa AA seqDB search
MSDAEGRWQGVNLAVACLALDPAALGGFWVRARVGPVRDQLENGLKTALQGLSLRRIAPT
MPDDALFGGIDLAATLDTGVLTETRGLLADPGVLLLPMAERVEPGLAGRLAGALDAGRGL
SIIAFDEGAEPGERAPDALLDRLAIHIDLTDHALSDAPGLAIDLDALTEARARLPLISTP
DTAIAELAEVAARLGILSLRAPLQALAVARASAALSGADEIEDADLLTAVELVLAPRATR
MPEAPEDTQDDPPPPPDDTTPDRPEDEIEEQLDLPPADILLEAARAMLPPDLLARLAPGK
AARAAKATGSGAAKTGNRRGRPLPPRVGRMGGNARVDLVATLRAAAPWQKIRQDITGVTD
RVHVRMSDIRIRRFKEASDRAIIFVVDASGSSAMARLAEAKGAVELLLAEAYSRRDHVAL
VAFRGDGAEVLLPPTRSLVQTKRRLASLPGGGGSPLAAGLRAALHLAALAKGKGMTPSVA
LLTDGRANVDLTGTANRTTAAEDASNMARAIRSEGYPGLVIDTGQRPTRGLDALAREMGA
PYLPLPRADSRNLSRAVDAALTP
NT seq 1692 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgacgcagagggacgctggcaaggggtcaaccttgcggtcgcgtgcctcgcactg
gacccggcagcattgggcggattctgggtccgcgcgcgcgttggacctgttcgcgatcaa
ctggaaaacggtctcaaaaccgccttgcagggtctgtccttgcgtcgaattgcaccaacg
atgcccgatgacgccttgttcggtggcattgacctggccgcaaccctcgacaccggagtt
ctgaccgaaacgagggggcttctggcggatcctggcgtgcttctcctgccgatggcggag
cgtgtggagccgggcctggccgggcggttggctggcgcgctcgatgcgggtcgtggcctg
tcgatcatcgcgtttgatgaaggggcggagcctggggaacgcgcgcctgacgccttgctt
gatcggctcgccatccacatcgatcttaccgatcacgcgctctccgacgcgcccggtctg
gccattgacctggacgcgttgaccgaggcgcgcgcacgtttgccgctgatcagcacgccc
gacactgcaatagccgaactggcagaggtggccgcccggctgggaattctgtctctgcgc
gcgcccttgcaggccctggctgtcgcccgcgcctctgccgccttgtcaggggccgatgag
attgaggacgcggaccttctgaccgccgtggagctggtcctcgccccccgtgcgacccgg
atgcccgaggcaccggaagacacccaggatgatccgccgccgccgcccgacgacaccacg
ccagaccggccggaagacgagattgaagaacaactggatctgccacccgccgacattctg
ctggaagctgcacgggcgatgctgccaccggatcttctggcgcggctggcccccggtaag
gcagcccgtgccgccaaagccaccggctccggggccgctaagactggcaatcgtaggggg
cgtccactgccgccacgcgttggacgaatgggcggcaacgcacgggttgatctggtcgcc
acgcttcgcgctgccgccccttggcagaagatccggcaagacatcaccggcgtgacggac
cgtgtgcatgtgcggatgtcagacattcgtattcggcgcttcaaagaggcgtcagaccgc
gcgatcatctttgtggtcgatgcctcgggatcaagcgcaatggcacggttggcagaggcc
aaaggtgccgtggaattgctgttggcagaagcctattcccggcgcgatcacgtggctttg
gtggcgtttcgaggcgatggagcagaggttcttctgccgcccacgcgatcgctggtccag
acgaagcgccgattggccagcctgccgggcggcgggggctctccgctcgcggcggggctg
agggcggcgttgcatctggcagcgttggccaaaggcaagggcatgacgccctcggtcgct
ttgctgactgacggtcgcgcgaatgtggacctgacgggtacggcgaacaggacaacggct
gcggaggatgccagcaatatggcccgtgcgatccgaagcgagggctacccgggattggtc
atcgacacaggtcaacgtccgacccggggcctcgacgccctggcccgcgaaatgggtgcg
ccctatcttcccctgccgcgcgcggacagccgcaacctctcacgcgccgtggacgcggcg
ttgacgccgtga

DBGET integrated database retrieval system