KEGG   Jannaschia sp. CCS1: Jann_0148Help
Entry
Jann_0148         CDS       T00330                                 

Definition
cytochrome c, class I
Orthology
K08738  
cytochrome c
Organism
jan  Jannaschia sp. CCS1
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Jann_0148
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Jann_0148
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(139246..139692)
Genome map
AA seq 148 aa AA seqDB search
MQRLTVLATAATLLAAPVLADGHATGDAEAGERAFRQCISCHVVVDADGETLAGRNARTG
PNLYGIHGRPIGSVEDFRYSNGLTALMEAGMEWDEAAFVGYVQDPTGWIREAADDDSLRG
AMSFRVRSEEDALNLYAYLVSLGGPEAE
NT seq 447 nt NT seq  +upstreamnt  +downstreamnt
atgcagcgactaactgttctcgccacggcggcaacactccttgcggcgccggtactggct
gacggccatgccacgggcgacgcagaagctggcgagcgcgcgttccgtcagtgcatttcc
tgccacgtggttgtggatgcggacggcgaaactctggccggacgcaatgcgcgcaccggt
ccgaacctctatggcattcacgggcgccctatcgggtctgttgaagacttccggtattcc
aacggtctgacggccctgatggaagcggggatggaatgggacgaggcggcgtttgttggc
tacgtccaagacccaaccggctggattcgcgaagccgcagatgacgacagcctgcgcggc
gcgatgagcttccgggttcgctcggaagaggatgcgctgaacctctacgcctatctcgtg
tccctgggtggacccgaggcggagtaa

DBGET integrated database retrieval system