KEGG   Jannaschia sp. CCS1: Jann_0218Help
Entry
Jann_0218         CDS       T00330                                 

Definition
UDP-glucose pyrophosphorylase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    Jann_0218
   00052 Galactose metabolism
    Jann_0218
   00500 Starch and sucrose metabolism
    Jann_0218
   00520 Amino sugar and nucleotide sugar metabolism
    Jann_0218
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     Jann_0218
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
212950..213843
Genome map
AA seq 297 aa AA seqDB search
MKKKVTKAIFPVAGLGTRFLPATKSIPKEIMTLVDRPLIQYAIDEARAAGIKEFIFVTSR
GKSALEDYFDHTPELENTLRKKGKTDMLEMLKSTNMDSGAIAYMRQHKALGLGHAVWCAR
RLLGNEPFAVILPDDVIAADTPCLQQMVEAHAELGGNMVAAMEVPDDKTSSYGILDVKED
MGSVVSVKGMVEKPPQDKAPSNLAVIGRYILSPDVMGHLNKIKSGAGGEIQLTDAIAQEI
VSADNVYGYRFKGQRFDCGSKAGFLQATVAFGLARDDLRDEFQDYLADMMSARSAAQ
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagttaccaaggcgatctttccggtcgcgggtcttggcacccgtttccta
ccagcgaccaaatcgatcccgaaagagatcatgaccttggtcgaccgccccctgatccaa
tacgcgattgacgaagcccgcgctgctggcatcaaggagttcatctttgtgaccagtcgc
ggcaagtccgcgctggaagactacttcgatcatacgccagagcttgagaacaccctgcgc
aagaagggcaagaccgacatgttggagatgctgaaaagcaccaacatggattcgggcgcg
attgcgtatatgcgtcaacacaaggctctgggtctgggtcacgcggtctggtgtgcccgg
cgattgctgggaaatgagccatttgccgtgatcctgcctgatgacgtgatcgcagccgac
acgccctgcctgcaacagatggttgaggcgcacgctgaacttggcggcaatatggtcgcg
gccatggaagtgccggacgacaagacatcctcctacgggattttggatgtgaaagaggat
atggggtccgttgtgtccgtgaagggcatggttgagaaaccgcctcaggacaaagcgccc
tccaacctggccgtgatcgggcgctatattctttcgccggacgttatggggcacctcaac
aaaatcaaatccggcgcagggggtgagattcaattgaccgacgccatcgcgcaggaaatc
gtcagtgcggacaacgtctatggctatcggttcaagggtcagaggttcgattgcgggtcc
aaggcgggctttttgcaggcaacggtggcgtttggtctggcgcgtgatgatcttcgggat
gagtttcaggattacctcgccgacatgatgtctgcccgaagcgcggcccagtaa

DBGET integrated database retrieval system