KEGG   Jannaschia sp. CCS1: Jann_0486Help
Entry
Jann_0486         CDS       T00330                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
jan  Jannaschia sp. CCS1
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Jann_0486
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.148  4-(cytidine 5'-diphospho)-2-C-methyl-D-erythritol kinase
     Jann_0486
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
485706..486536
Genome map
AA seq 276 aa AA seqDB search
MSAATFRGYAPAKVNLALHVTGRRVDGYHELDSLVVFAGVGDRLEIAPADALSLTVTGPR
AEGVPDDARNLVWKAADWLAPGRGAAMTLDKHLPHAGGIGGGSADAACALRGLAEIWDVD
VPDGAEALGADVPVCLHGQPVRMRGIGDVLDAVPPLPPMWIVLVNAGVEVPTGAVFKAME
RVDNPPLPAPAWDGFDSFLVWLERTRNDMESSARSQAPVIGMVLERLRALPGCRFTRMSG
SGGTCFGLFETEIAARDAALGLPKHWWVTYAPVLRA
NT seq 831 nt NT seq  +upstreamnt  +downstreamnt
gtgagcgccgccaccttccggggatatgcgcccgccaaggtcaacctcgcgctccatgtg
acggggcggcgcgttgatggatatcatgagctggatagtctggtcgtcttcgcgggtgtg
ggggaccggctggagatcgcgcctgccgatgcgttgtcgttgacggtcaccgggccaagg
gccgaaggggtgcccgatgacgcgcgcaatctggtgtggaaggctgcggattggttggcc
cccgggcgtggcgcggcgatgaccctggacaagcatctgccccatgcgggtggaattggc
ggcggatctgccgatgcggcctgtgcgctacgggggttggccgagatctgggacgtcgat
gtgcccgacggggccgaggcgcttggcgcggacgtgcccgtctgcctgcacggacagccc
gttcggatgcgcgggatcggcgatgtgctggatgccgtgcccccgctgccgccgatgtgg
atcgtactggtcaacgcaggcgtcgaggtgccgacgggggccgtcttcaaggcgatggag
cgggtggacaatccgccgctgcccgcgcccgcctgggatgggttcgacagcttcctcgtg
tggctagagcggacccggaatgatatggaatcctccgcgcgcagccaggccccggtgatc
ggtatggtgctggaacgcctgcgcgcccttcccggatgccggttcacccggatgagcggg
tccggcggcacatgctttggcctgttcgagaccgagatcgccgcccgcgatgcggccctg
ggtctgcccaagcactggtgggtgacctacgcgcccgtcttgagggcatag

DBGET integrated database retrieval system