KEGG   Jannaschia sp. CCS1: Jann_0512Help
Entry
Jann_0512         CDS       T00330                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
jan  Jannaschia sp. CCS1
Pathway
Folate biosynthesis
Metabolic pathways
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:jan00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
506413..507000
Genome map
AA seq 195 aa AA seqDB search
MYTNDARAGLIALGANLPSGGLPPEISVPKAMARLVERVGGPHSQSRLFHTPAFPPGSGP
QFVNAAVKIEWRGHAGELLALLHEIEEEFGRTRAHRWEARVMDLDLIGLGDAILPDAATR
ANWANLPPERAAQVVPDQLILPHPRLAERGFVLVPLADIAPEWVDPATGLTVAEMLAARP
HAELAGIHPVPVAAE
NT seq 588 nt NT seq  +upstreamnt  +downstreamnt
atgtatacaaatgacgcgagggcaggcctaattgcgctgggtgcaaacctgccttccggc
ggattgccgccggaaatcagcgtaccgaaggcaatggcccggttggtggagcgagtgggc
ggcccccacagtcaaagccgcttgtttcacacgcctgccttcccgccggggtcggggccg
caattcgtcaatgcggctgtaaagatcgagtggcgcggccatgccggggaacttctggcc
ctgctccacgagattgaagaggaatttggtcggacccgcgcccatcgttgggaggcgcgg
gtgatggatctggatctgatcggcctgggcgatgcgatcctgccggatgcggccacgcgg
gccaattgggcgaatctgccgccggagcgggcggcgcaggtggtgcccgatcagctgatt
ctcccccatccgcgtttggcagagcggggattcgtgctggtgcccctggccgatatcgcg
cccgaatgggtggatccggccaccggcctgaccgtggccgagatgctggcggcgcgtccc
catgccgagctggcggggatccatccggtgcctgtcgcagcggaataa

DBGET integrated database retrieval system