KEGG   Jannaschia sp. CCS1: Jann_0711Help
Entry
Jann_0711         CDS       T00330                                 

Definition
Delta-9 acyl-phospholipid desaturase
Orthology
K00507  
stearoyl-CoA desaturase (delta-9 desaturase) [EC:1.14.19.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Biosynthesis of unsaturated fatty acids
Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    Jann_0711
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Jann_0711
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     Jann_0711
Lipid biosynthesis proteins [BR:jan01004]
 Desaturase
  First
   Jann_0711
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(683782..684687)
Genome map
AA seq 301 aa AA seqDB search
MAQELTATDRVTPRQDCSATQGRVVWAPAKSLWFSAMALGGVVGVVVFPSWGAAGVTLVL
MLLTLCLGHSVGMHRLLIHRSFRTPRWLEYVLMYLGTLVGMAGPIGMFQIHEIRDWQQQQ
PDCHSFAKHDVGFWRDAMWQMHCEQRLDHPPALHIEDRVAQDPFYRWLEATWRWQQLPLA
ALLFAMGGVGFVLWGIGLRVAVSLAGHWVTVHFAHTRGERPFVQDDIAVDGRNLPALGFV
TFGEAFHNNHHAFPRSARMGHHAGQIDPGWWVIRTLGAVGLAWDIRTPHSNDTLDLEGAY
S
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atggcacaggaattgacggcaacagaccgtgtgacgccacggcaagactgctccgccacc
cagggccgggtcgtctgggcacctgcaaaatccctgtggttcagcgccatggccctcggg
ggcgtcgtcggtgtcgtggtcttcccgtcgtggggggcagcaggcgtgacgctcgtgctg
atgctgttgacgctgtgcctcgggcattcggtcggcatgcatcgcctcttgatccatcgc
agcttccgcacgccacgctggttggaatatgtgctgatgtatctgggcacgttggtgggg
atggcggggccaattgggatgttccagatccatgagatccgcgattggcaacaacagcag
cccgattgccattccttcgccaaacacgacgtgggcttctggcgcgatgcaatgtggcag
atgcactgtgagcaaaggctggatcatccgcccgccctgcacatcgaagaccgcgtggcg
caggatccattctatcgctggctggaggccacctggcgatggcagcaattgcctctcgcg
gcgctgctgttcgcgatgggtggggttgggtttgtgctgtgggggattggtttgcgggtg
gccgtgtccctcgccgggcattgggtgacggtgcatttcgcccatacaaggggcgaacgt
cccttcgtccaggacgacatcgcggtggacgggcgcaacctgcccgccctgggcttcgtg
acctttggagaggcgttccacaacaaccaccacgccttcccgcgctcggcgcgtatgggt
catcacgcggggcaaattgaccccggctggtgggtgatccgaactctgggcgcagtcgga
ttggcatgggacatccgcacgccccacagcaatgacacactggaccttgaaggagcctac
tcatga

DBGET integrated database retrieval system