KEGG   Jannaschia sp. CCS1: Jann_0821Help
Entry
Jann_0821         CDS       T00330                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jann_0821
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jann_0821
   00640 Propanoate metabolism
    Jann_0821
   00660 C5-Branched dibasic acid metabolism
    Jann_0821
Enzymes [BR:jan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Jann_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
778221..779414
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLAQYGAPVSDGRVVTKAEDAKTAAGEMDGPLWVVKAQIHAGGRGKGKFK
EADAGEAGGVRLAKSAQEAADEAKKMLGRTLVTHQTGPVGKQVNRIYIEDGSGIETEMYL
ALLVDRQSSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPATGYQPYHGRRVAFSLGLE
GQQVKQCVKLMGQLFTAFQEKDMEMLEINPLIVTDEGNLKVLDAKVSFDGNAVYRHADVA
SLRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPQVKGIFVNIFGGIMRCDIIAEGVIAAVKEVGLQMPLVVRLE
GTNVEKGKEIINNSGLDVIAADDLKDGAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaggcgaaagcccttctcgcgcaatacggcgctccggtgtct
gacggacgcgttgtcacgaaggcggaagacgccaagaccgccgccggagagatggacggg
ccgctttgggtcgtgaaagcgcagatccacgcgggcggccgcggcaagggcaagttcaag
gaagctgacgctggagaggcgggcggtgtgcgccttgcgaaatccgcgcaggaggcagcg
gacgaggccaagaagatgttgggccgcacgcttgtgacgcaccagaccggccccgtaggc
aagcaggttaaccggatctacatcgaagacggctcgggcatcgagaccgagatgtatctg
gcgcttctggtggatcgccagtccagccgcatcagctttgtctgctccaccgaaggtggc
atggacatcgaagaggtcgccgcgtcgacgcctgaaaaaatcctcagcttctccgtcgat
ccggccacgggctaccagccttaccatggtcgccgcgtggcgttttcgctggggcttgag
gggcaacaggtcaagcaatgcgtcaagctgatgggtcagctcttcaccgccttccaggag
aaggacatggagatgctggagatcaacccgctgatcgtgacggatgaaggcaacctcaaa
gtgctcgatgcgaaggtcagttttgacggcaacgctgtctaccgccacgccgatgtggcg
tccttgcgggacgagacggaagaggaccccaaggaactggccgcgtccaagttcgacctc
aactacatcgcgctcgacggtgaaatcggctgcatggtcaacggcgcgggcctggccatg
gcgacgatggatatcatcaagctttatggcgcggagcctgcaaacttcctcgacgtgggc
ggcggcgcgaccaaggagaaggtgacggaggcgttcaaaatcatcacttctgacccgcag
gtgaagggcattttcgttaacatcttcggcggcatcatgcgctgcgatatcatcgcggaa
ggcgtgatcgcagcggtgaaagaggtcggcctgcaaatgccgctggtggtgcgtctggaa
ggcacgaacgtggagaagggcaaggagatcatcaacaattccggcctcgacgtgatcgcc
gccgacgacctgaaagacggcgcgcagaagatcgtgaaggctgtgaagggatag

DBGET integrated database retrieval system