KEGG   Jannaschia sp. CCS1: Jann_0821Help
Entry
Jann_0821         CDS       T00330                                 

Definition
(GenBank) succinyl-CoA synthetase (ADP-forming) beta subunit
  KO
K01903  succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00020  Citrate cycle (TCA cycle)
jan00640  Propanoate metabolism
jan00660  C5-Branched dibasic acid metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Module
jan_M00009  Citrate cycle (TCA cycle, Krebs cycle)
jan_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jann_0821
   00640 Propanoate metabolism
    Jann_0821
   00660 C5-Branched dibasic acid metabolism
    Jann_0821
Enzymes [BR:jan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Jann_0821
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ATP-grasp_2 Ligase_CoA ATP-grasp_5 GARS_A
Motif
Other DBs
NCBI-ProteinID: ABD53738
JGI: Jann0821
UniProt: Q28U74
Position
778221..779414
Genome map
AA seq 397 aa AA seqDB search
MNIHEYQAKALLAQYGAPVSDGRVVTKAEDAKTAAGEMDGPLWVVKAQIHAGGRGKGKFK
EADAGEAGGVRLAKSAQEAADEAKKMLGRTLVTHQTGPVGKQVNRIYIEDGSGIETEMYL
ALLVDRQSSRISFVCSTEGGMDIEEVAASTPEKILSFSVDPATGYQPYHGRRVAFSLGLE
GQQVKQCVKLMGQLFTAFQEKDMEMLEINPLIVTDEGNLKVLDAKVSFDGNAVYRHADVA
SLRDETEEDPKELAASKFDLNYIALDGEIGCMVNGAGLAMATMDIIKLYGAEPANFLDVG
GGATKEKVTEAFKIITSDPQVKGIFVNIFGGIMRCDIIAEGVIAAVKEVGLQMPLVVRLE
GTNVEKGKEIINNSGLDVIAADDLKDGAQKIVKAVKG
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgagtatcaggcgaaagcccttctcgcgcaatacggcgctccggtgtct
gacggacgcgttgtcacgaaggcggaagacgccaagaccgccgccggagagatggacggg
ccgctttgggtcgtgaaagcgcagatccacgcgggcggccgcggcaagggcaagttcaag
gaagctgacgctggagaggcgggcggtgtgcgccttgcgaaatccgcgcaggaggcagcg
gacgaggccaagaagatgttgggccgcacgcttgtgacgcaccagaccggccccgtaggc
aagcaggttaaccggatctacatcgaagacggctcgggcatcgagaccgagatgtatctg
gcgcttctggtggatcgccagtccagccgcatcagctttgtctgctccaccgaaggtggc
atggacatcgaagaggtcgccgcgtcgacgcctgaaaaaatcctcagcttctccgtcgat
ccggccacgggctaccagccttaccatggtcgccgcgtggcgttttcgctggggcttgag
gggcaacaggtcaagcaatgcgtcaagctgatgggtcagctcttcaccgccttccaggag
aaggacatggagatgctggagatcaacccgctgatcgtgacggatgaaggcaacctcaaa
gtgctcgatgcgaaggtcagttttgacggcaacgctgtctaccgccacgccgatgtggcg
tccttgcgggacgagacggaagaggaccccaaggaactggccgcgtccaagttcgacctc
aactacatcgcgctcgacggtgaaatcggctgcatggtcaacggcgcgggcctggccatg
gcgacgatggatatcatcaagctttatggcgcggagcctgcaaacttcctcgacgtgggc
ggcggcgcgaccaaggagaaggtgacggaggcgttcaaaatcatcacttctgacccgcag
gtgaagggcattttcgttaacatcttcggcggcatcatgcgctgcgatatcatcgcggaa
ggcgtgatcgcagcggtgaaagaggtcggcctgcaaatgccgctggtggtgcgtctggaa
ggcacgaacgtggagaagggcaaggagatcatcaacaattccggcctcgacgtgatcgcc
gccgacgacctgaaagacggcgcgcagaagatcgtgaaggctgtgaagggatag

DBGET integrated database retrieval system