KEGG   Jannaschia sp. CCS1: Jann_1067Help
Entry
Jann_1067         CDS       T00330                                 

Definition
protein-L-isoaspartate O-methyltransferase
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
jan  Jannaschia sp. CCS1
Brite
Enzymes [BR:jan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Jann_1067
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1028831..1029499)
Genome map
AA seq 222 aa AA seqDB search
MSDLGRGEGTGFDAERKMQFLYQLRQKGVMDKRVLTAMEHVDRGAFVRGHFASRAYEDVP
LPISSGQTISQPSVVGLMTQALNVQPRDTVLEVGTGSGYQAAILSHLARRIYTIDRHRNL
TREAEIIFTRMGLVNITVLTRDGSFGLPDQGPFDRILITAAAEDPPGPLLQQLKVGGVMV
VPVGQSDTVQSLIKVTRLETGFDYDELMPVRFVPLVEGTARD
NT seq 669 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacctcgggcgcggcgaggggacaggctttgatgccgagcgcaagatgcagttc
ctctaccagctgcgccagaagggcgtcatggataaacgcgtgctgaccgcgatggagcat
gtggatcgcggcgcgttcgtgcgcggtcatttcgcgtcccgcgcctatgaagacgtgccc
ctgccgatcagttcgggccagacgatcagccagccctccgtcgtggggctgatgacgcag
gcgctgaacgtccagccgcgcgatacggtgctggaggtgggcacagggtccggctatcag
gccgcgatcctcagccatctggcgcggcgcatctacacgattgaccgccaccgcaatctg
acccgcgaggcggagatcattttcacgcggatgggcttggtcaatatcacggtgctgacc
cgcgacggctccttcgggctgccggatcagggcccctttgaccggatccttatcaccgcc
gccgctgaagaccccccgggtccgctgctgcaacaactcaaggtcgggggcgtgatggtc
gtgccggtcggccaatcggacacggtgcaaagcctgatcaaggtcacgcggctggagacg
ggctttgactatgacgagttgatgcccgtccgctttgtgccgctggtggagggcacggcc
cgcgactag

DBGET integrated database retrieval system