KEGG   Jannaschia sp. CCS1: Jann_1688Help
Entry
Jann_1688         CDS       T00330                                 

Definition
branched-chain alpha-keto acid dehydrogenase subunit E2
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:jan01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:jan00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:jan00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:jan00620]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1670782..1672107)
Genome map
AA seq 441 aa AA seqDB search
MPIELLMPALSPTMEEGTLAKWLVKEGDTVNSGDLLAEIETDKATMEFEAVDEGIIGKIL
VPEGTENVKVNTAIALIGEEGDDFSAAPAAPAEDAAAEEASPEAEEVTPSEAAPAAASSA
PAAPVTKDGGRIFASPLARRIAKDKGLDLSQIKGSGPHGRIVKVDVEGASAAPKSEAPTA
KSEAPKAAAPAGGGAMPTGPSAEQVLKMYEGREFEEVKLNGMRKTVAARLTEAKQTIPHF
YLRRDIQLDALLKFRSQLNKQLEGRGVKLSVNDFVIKACALALQAVPDANAVWAGDRMIK
LKPSDVAVAVAVDGGLFTPVLKDSDSKSLSALSAEMKDLATRARDGKLAPHEYVGGSFAI
SNLGMMGIENFDAVINPPHGAILAVGAGVKKPVVGADGELAVATVMSTTLSVDHRVIDGA
LGAELLAAIKDNLENPMVMLA
NT seq 1326 nt NT seq  +upstreamnt  +downstreamnt
atgcccatcgaacttctcatgcccgccctctcccccacgatggaggaaggcaccctggcg
aaatggcttgtcaaggaaggcgacaccgtcaattccggcgatctgctggccgagatcgag
accgacaaggcgacgatggaattcgaggccgtcgatgaggggatcatcggcaagatcctg
gtcccggaggggaccgagaacgtgaaggtcaacaccgccatcgccctgatcggcgaggaa
ggcgacgacttcagcgccgcgccagcggccccggccgaagatgccgccgccgaggaggcc
tcgccagaggccgaggaggtgaccccttcagaagcggctcctgccgcggcctcttctgcg
cccgctgcacctgtcaccaaggacggaggtcgcatcttcgcctcccccctcgcccgccgg
atcgccaaggacaaaggtctggatctgagccagatcaagggctccggcccccatggccgc
atcgtgaaggtcgacgtggaaggtgccagcgccgcgcccaagtccgaagcccccaccgcc
aaatccgaggccccgaaagccgccgcacccgccggtggcggcgcgatgcccaccggtcca
tccgccgagcaggtccttaagatgtatgaaggccgcgagtttgaagaggtcaaactcaac
ggcatgcgcaagaccgtcgccgcccgcctgaccgaggccaagcagacgatcccgcatttc
tacctgcgccgcgacattcagctggacgctctgctgaaattccgctcccagctcaacaaa
cagctggaaggccgcggcgtgaagctttccgtcaacgacttcgtcatcaaggcctgcgcc
cttgcgttgcaggcggtgcccgacgccaacgccgtctgggccggtgaccggatgatcaaa
ctgaagccatccgatgtggccgtggccgtggccgtcgatggcggcctcttcacgccggtc
ctgaaggatagcgacagcaaaagcctctcggccctctcggctgaaatgaaggacctcgcc
acccgcgcccgggacggcaagctggccccccacgaatacgtgggtggctcctttgccatc
tccaatctcggcatgatggggatcgagaatttcgatgccgtcatcaacccgccccatggc
gcgattctggctgtcggtgcgggcgtcaagaagcctgtcgtcggcgcggatggagagctg
gcagtcgcgaccgttatgtccaccaccctgtcggtcgatcaccgtgtcattgacggcgcc
ctgggcgcagagcttttggcggccatcaaggacaatctggaaaacccgatggtcatgctg
gcctga

DBGET integrated database retrieval system