KEGG   Jannaschia sp. CCS1: Jann_1733Help
Entry
Jann_1733         CDS       T00330                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jann_1733
   01230 Biosynthesis of amino acids
    Jann_1733
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_1733
   00051 Fructose and mannose metabolism
    Jann_1733
   00562 Inositol phosphate metabolism
    Jann_1733
Enzymes [BR:jan01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Jann_1733
Exosome [BR:jan04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Jann_1733
  Exosomal proteins of bladder cancer cells
   Jann_1733
  Exosomal proteins of melanoma cells
   Jann_1733
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1726402..1727148)
Genome map
AA seq 248 aa AA seqDB search
MARKLAAGNWKMNGVEADLAEVDALGEAVAAANCDVLLCPPATLIAPMAKRAGLMDLYVG
GQTCHTAASGAHTGDVSAAMLADAGASHVILGHSERRADHGERSEDVAAQVTAAIDANLI
AIICVGETEAERDANVTLNVVSSQLAGSIPTGATPAQIVVAYEPVWAIGTGRTPTLEQIA
EVHDHIRSELAARRGSAANDIPLLYGGSVKPGNAAEIFAVSNVDGALVGGASLKASDFGG
IIAALSAA
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggcacggaaactggcggcaggcaattggaagatgaacggggtagaggccgatttggcc
gaggtggacgctttgggcgaggctgttgcggcggccaattgcgacgtcttgctgtgcccg
cccgcgacgctgattgcgccgatggccaagcgcgcggggttgatggacctctatgtcggc
ggccagacatgccatacggccgcgtcgggcgcgcacactggcgacgtgtcggcggcgatg
ctggccgacgcgggcgcgagccacgtgatccttggccattcggaacgacgcgcagaccat
ggcgagcgcagcgaagatgtggcggcccaggtcacggccgccattgacgccaacctgatc
gcgatcatctgcgtcggcgaaaccgaagccgagcgtgatgcgaatgtgaccctgaacgtc
gtctccagccagttggcaggctccatccccaccggcgccacgcccgcgcagatcgtcgtg
gcctatgagcccgtctgggccatcggcacgggccgcacgccgacgctggaacagattgcc
gaggtccatgatcacatccggtctgaactggccgcgcgccggggcagcgccgccaatgat
atcccgctgctctatggcggatcggtcaagcccggcaatgccgcagagatctttgcggtg
tccaatgtggacggcgcgctggtcggtggcgcatcgttgaaggcgtcggatttcggcgga
attatcgccgccctgtccgccgcctga

DBGET integrated database retrieval system