KEGG   Jannaschia sp. CCS1: Jann_1845Help
Entry
Jann_1845         CDS       T00330                                 

Definition
malate synthase G
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jann_1845
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    Jann_1845
   00630 Glyoxylate and dicarboxylate metabolism
    Jann_1845
Enzymes [BR:jan01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     Jann_1845
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1831612..1833750
Genome map
AA seq 712 aa AA seqDB search
MTSRVEKCGLQVAPELADFLEAQALPGSGVAAQTFWQGFSDLAHDLAPKNAALLARRDDL
QSQIDQWHIAHRDTAHDADAYHAFLSEIGYLVPEGEGFEIDTSNIDPEIATVAGPQLVVP
ITNARFALNAANARWGSLYDAFYGTDAMGSRPTKGGYDRGRGARVVARARVFLDEAFPIV
GTSHADVRRYHIEKGALLVDDKPLADPSQFAGYRGRAKAPDGVLLVNNGLHVELVFDRAH
TIGARDQAGLADVRMESAVSAIMDCEDSVACVDAEDKVLAYANWLGLMKGNLSETFEKGG
AQITRALAPDLQFTAPDGSDKIVKGRALTLVRNVGHLMTNPAVLLRDGAEIYEGLMDAMI
TTLIAMHDLVRDGGNSVAGSVYVVKPKMHGPDEVAFTNEIFTRVEAALGLPDYTVKIGIM
DEERRTSVNLKECIRAAKHRVAFINTGFLDRTGDEIHTSMEAGPFSRKDFIKRKGWITAY
ENQNVDIGLECGLRGRAQIGKGMWAKPDAMAEMLEQKIEHPRAGANCAWVPSPTAATLHA
LHYHKVNVADVQARLQAGGKRAYVTALLDIPLAAYRRWTREQVIREVENNAQGILGYVVR
WIDQGVGCSKVPDINGVELMEDRATCRISAQHIANWLHHNVLTEADVGEVFRRMAVVVDA
QNAGDPLYRPMAPGFNGIAYAAALDLVLKGRAQPSGYTEPVLHARRLEWKAG
NT seq 2139 nt NT seq  +upstreamnt  +downstreamnt
atgacgtcacgggtcgagaaatgcggtttgcaggtggcaccagagttggccgatttcctt
gaggcgcaggcgctgcctggcagcggtgtcgcggcccagaccttctggcaaggcttctcg
gacctggcccacgatctggccccaaagaacgcggccctgttggcgcggcgcgatgacctg
caatcgcagatcgatcaatggcacattgcccaccgcgacactgcccatgacgcggatgcc
taccacgcgttcctcagcgagatcggttatcttgtgcccgagggggaggggttcgaaatc
gacacctccaacattgacccggaaattgccacggtcgcaggcccgcaattggtcgtgccc
atcaccaacgcgcgctttgccctgaacgcagccaatgcccgctggggcagcctctacgac
gccttctatggcaccgatgccatggggtcccgtcccaccaagggcggctatgaccggggg
cggggggcgcgtgtcgtggcccgcgcgcgggtgtttctggacgaggcgttcccgattgtc
ggcacctcccacgccgatgtgcgccgctaccacatcgaaaagggcgcgctgctggtggat
gacaagcccctggccgatccgtcgcaattcgcaggctaccggggccgcgcgaaagccccc
gatggggtgcttctggtcaataacggccttcatgtggagctggtctttgaccgcgcccac
accatcggcgcgcgggatcaggcggggctggcggacgttcggatggaaagtgcggtctct
gcgatcatggattgcgaggacagcgtcgcctgcgtcgatgccgaggataaggttctggcc
tatgccaactggctcggcctgatgaagggtaacttgtccgagacgttcgagaagggcggg
gcacaaatcacccgcgccctggccccggaccttcagttcaccgcgcccgatggcagcgac
aagatcgtgaagggccgcgcgctgacgctggtgcgcaatgtgggccacttgatgaccaac
cccgccgtgctcctgcgcgatggcgcggagatttatgaaggcctgatggacgcgatgatc
accacgctcatcgcgatgcatgatttggtgcgggatggcggcaattccgttgcgggctca
gtctacgtcgttaaacccaagatgcatggccccgacgaagtcgccttcaccaacgagatc
ttcacccgggtcgaggcggccctcggcctgccggactacacggtcaagattggtatcatg
gatgaggaacggcgcacgtcggtgaacctcaaggagtgtatccgggccgccaagcaccgg
gtcgcgttcatcaataccggctttctcgaccgcaccggtgacgagatccatacgtccatg
gaagccgggccgttctcccgcaaggacttcatcaagcgcaagggctggatcacggcctat
gaaaaccagaacgtcgatatcgggctggaatgcggcttgcgaggccgggcacagatcggc
aaggggatgtgggccaaaccggacgccatggccgagatgctggagcagaagattgaacat
ccccgcgcgggtgccaattgcgcctgggtgccatcgcccacggcggccacgctgcacgcg
ctgcattaccacaaggtgaacgtggccgatgtgcaggcgcgtctgcaagcggggggcaag
cgcgcctatgtcaccgcgctgctggatattccgctggccgcctatcgccgctggacccgg
gagcaggtgatccgcgaggtggaaaacaacgcgcaggggatcctgggctatgtcgtgcgg
tggatcgatcagggcgtgggatgctccaaagtgccggatatcaacggggtggagttgatg
gaggaccgcgcaacctgccggatctcggcgcaacatatcgccaactggctgcaccataac
gtcctgaccgaggcggatgtgggcgaggtcttccgccgcatggccgtggtggtggatgcg
caaaacgccggcgatccgctgtatcggcccatggcgccgggcttcaacgggatcgcctat
gcggcggcgttggaccttgttttgaagggccgggcgcagccatcgggttacaccgagccc
gttcttcacgcgcgccggttggagtggaaggcgggctaa

DBGET integrated database retrieval system