KEGG   Jannaschia sp. CCS1: Jann_1943Help
Entry
Jann_1943         CDS       T00330                                 

Definition
(GenBank) glucokinase
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00010  Glycolysis / Gluconeogenesis
jan00052  Galactose metabolism
jan00500  Starch and sucrose metabolism
jan00520  Amino sugar and nucleotide sugar metabolism
jan00521  Streptomycin biosynthesis
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Module
jan_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_1943
   00052 Galactose metabolism
    Jann_1943
   00500 Starch and sucrose metabolism
    Jann_1943
   00520 Amino sugar and nucleotide sugar metabolism
    Jann_1943
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Jann_1943
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    Jann_1943
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Jann_1943
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glucokinase ROK
Motif
Other DBs
NCBI-ProteinID: ABD54860
JGI: Jann1943
UniProt: Q28R02
Position
complement(1933645..1934592)
Genome map
AA seq 315 aa AA seqDB search
MVPAALSLVADIGGTNTRVALAHGAEVQVDSVRRYRNAEFDGIGSVIARYLGDSSQNHTF
ITGVCVAMAGPVHDGVGTLTNLDWRIDKAVLAEALSAERVAVLNDLQAQGHAIGHIAATD
LAEVLPQPEVAATAAKLVIGLGTGFNACPVFDTAAGRFVPPSEAGHVSLPTSIAELHPML
SKLSDSRGYPSVEEVLSGRGVSQLHAALHGEVIDPADILSRIGDGEAQACDTGALFVKVL
GDVAGNLVLSHLPFGGVFLVGGVTRAFAPYLDQFGFVEAFRSKGRFSTFMEQFGVSVVSD
DYAALTGCASHLSRG
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atggttcccgcagctctttcgctggtggccgatatcggtggcaccaacacccgtgtggcc
ctggcccatggggccgaggtccaggtcgatagcgtgcggcgctaccgcaatgccgagttt
gatggaataggctctgtcatcgcccggtatctgggcgacagtagccagaatcataccttt
attacaggggtttgcgtcgcaatggcggggcctgtccatgacggggtcggcaccctgacc
aatctggactggcgcatcgacaaggcagttctggcagaggcgttgagtgccgagcgcgtc
gccgtgttgaacgatttgcaggcccagggccacgcgattggccacatcgcggccaccgat
ctggcggaggttttgccgcagccggaggtggcggcaacggcggcgaaactggtcatcggc
ctgggcaccgggttcaacgcctgcccggtgtttgacaccgccgccggccgcttcgtgccg
ccgtcggaagccgggcatgtgagcctgcccacatctattgccgagctgcacccgatgctg
agcaagctgtcggattcccgcggatatccgtcggtggaagaggtgctgtcggggcgcggt
gtcagccagttgcacgcggccctccacggggaagtcattgatcccgctgatattttatct
cgtatcggcgatggtgaggcacaggcctgcgataccggcgcgctgtttgtgaaggtgttg
ggggacgttgcgggcaatctggtgctgtcgcatctgcccttcggcggcgtgttccttgtg
ggcggcgtgacgcgggcctttgcgccctatctggaccagttcggatttgtggaggcgttc
cggtccaagggccggttttcgaccttcatggagcagtttggcgtgtcggtcgtcagcgac
gattatgccgcgctgacgggctgcgcgagccatctgtcgcggggctga

DBGET integrated database retrieval system