KEGG   Jannaschia sp. CCS1: Jann_2108Help
Entry
Jann_2108         CDS       T00330                                 

Definition
xylose isomerase-like protein
Orthology
K01805  
xylose isomerase [EC:5.3.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pentose and glucuronate interconversions
Fructose and mannose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:jan00040]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:jan00051]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2116526..2117497
Genome map
AA seq 323 aa AA seqDB search
MSRPNRPRYAARLNAFKQLTPGSDVRDWIAAAGQVGGLGAADLNFPDHFAVYDADQMGNF
LGEAALTLNGIAMRYYTDPGFKLGAFTHPDAAVRQAALDVTKQGIDTCARMGGKTVTLWM
GQDGFDYAFQMDYGLAWDRTVAAIADICAHDPNIDIAIEYKPNEPRAFALMPDIGTTLLA
CREVGAVNLGVTLDFAHVLYADEMPAHSAALIGRHSRMIGLHLNDGYGKRDDGLMVGSVH
AIQTVELLVAMLRMGQTDVIYFDTFPDMGGLNPIEEARTNVAVTDRLMAVAESLMEDPAL
AQAIDRQDAAASHRIVARALYGS
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgagccgtccaaatcgcccccgctatgccgcgcggctcaacgcgttcaaacagctcacg
ccgggctcggatgtgcgggactggatcgcggcggcgggacaggtgggcggattgggggcg
gcggacctgaacttcccagaccattttgcggtctatgacgcggaccagatggggaatttt
ctgggggaggccgcgctgactttgaacgggatcgcgatgcggtactataccgaccccggt
ttcaaactgggcgcgttcacgcatcctgatgccgctgtcagacaggccgccttggatgtc
accaaacagggtatcgacacctgtgcccgcatgggcggcaaaacggtcactttgtggatg
gggcaggacgggttcgattatgcgtttcagatggattacgggctggcctgggatcgcacg
gtcgcggccatcgccgatatctgcgcccatgacccaaacatcgacatcgcgattgaatac
aaaccgaatgagccgcgggcctttgccctgatgccggatatcggcaccacgttgctggcc
tgccgcgaggtgggcgcggtcaatctgggcgtgacgctcgacttcgcccatgtcctttac
gccgatgagatgcccgcccattccgccgcgctgatcgggcggcattcgcggatgatcggc
ctgcatctgaacgacggctacggcaagcgcgacgatgggctgatggtgggctcggtccat
gccatccagaccgtcgaattgctggtcgcgatgctgcggatgggccagaccgatgtgatc
tatttcgacaccttccccgacatgggcggtctgaacccgattgaggaggcgcggaccaat
gtcgccgtcacggatcggcttatggcggttgcggaaagtctgatggaagatccagcgctg
gcgcaggcgattgaccggcaggatgcggcggcatcacaccggatcgtcgcgcgggccttg
tacggctcatga

DBGET integrated database retrieval system