KEGG   Jannaschia sp. CCS1: Jann_2109Help
Entry
Jann_2109         CDS       T00330                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Jann_2109
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Jann_2109
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2117494..2118342
Genome map
AA seq 282 aa AA seqDB search
MSLLVVGALHWDVVVQASRLPRIDETLRGSGVTYQFGGKAGNQAIAAAGAGADVGFAGRN
GTDEAGQSMQAALQDAGVDIAQLQAGAGASGMSVAILMEDGNYGAVIVSAENHMFDVDAV
QIPDECRLVLLQNEMAAGVIPAMATKAQRAGAGVILNAAPAQGVGKTDLAHLHTLIVNRV
EGADLLGIADSAPDPVAVVNGLQELAPQALVILTLGGDGVVFAEPGRAVQSQAARRVSVH
STHGAGDVFVGAYAAAILAGQSLSEAIQLGQAAAAAHISQIR
NT seq 849 nt NT seq  +upstreamnt  +downstreamnt
atgagcctgctcgttgtcggtgcgttgcattgggatgttgtggtgcaggcgtcccgtttg
ccccgcatcgacgagacgttgcgcggatccggcgtgacgtatcagtttggcggcaaggcc
ggaaatcaggcgatcgcggcggcaggggccggggcggatgtcggttttgctggccgcaat
ggcaccgacgaggcgggccagtccatgcaggcggctttgcaagatgctggtgtggacatc
gcacaattgcaggctggggcaggggcgtcggggatgagcgttgcgatcctcatggaggat
ggcaattacggggcggtgatcgtatcggccgagaaccatatgttcgacgtagatgccgtg
cagataccggacgaatgccgcctcgttctgttgcaaaatgagatggcggccggtgtgatc
ccggccatggcgacgaaggcccaacgcgcgggtgccggggtgatcttgaacgccgcaccg
gcgcagggcgttggcaagaccgaccttgcgcatctccacacgctgatcgtgaaccgggtc
gaaggggccgatctgttgggcattgcggacagcgcacctgatccggtggcggtggtcaat
ggcctgcaagagctggccccgcaggcgctggtgatcctgacactcggtggggacggcgtt
gttttcgctgagccgggccgggcagtgcagtcacaagccgcgcgccgggtctcggtacac
tccacccacggggcgggtgacgtgtttgtcggcgcttacgcggcggcgatcctggcgggg
caatcgctgtctgaagccatccagttggggcaagccgcagccgccgcccacatctctcag
atccggtag

DBGET integrated database retrieval system