KEGG   Jannaschia sp. CCS1: Jann_2321Help
Entry
Jann_2321         CDS       T00330                                 

Definition
glycoside hydrolase family protein
Orthology
K01185  
lysozyme [EC:3.2.1.17]
Organism
jan  Jannaschia sp. CCS1
Class
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2324353..2325378)
Genome map
AA seq 341 aa AA seqDB search
MHISHLGLSLIKHFEGQYLTTYIDPVGVATIGYGHTGDHAIPGNTITEAQALEILEEDLS
GHVASVRKHTDIAVEQHQFDALVSFAFNVGNLAYFNSTLRRLLNDRDRNGAADQFLRWDK
GTVDGRKIVLPGLSRRRKAERHLFNTGEVDFFDGHGVQTVAPDPASPSDTPPEPAPQPTP
TPVPRPTPNATSPHQYAADLNATLVAWGVTHFNAAELMEMGASNATPGSPAYGTNALPPR
DVWDNMRRTIQMLDRLREVLDQPIHILSGYRSPAYNQLVGGVPNSLHVQFNAIDFYVGGA
TRPAHWAAVLKDMRVAGEFRGGIGIYSSFVHIDTRGQNADW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcagtcatttgggattgtccctgatcaagcatttcgaaggtcagtatttgacc
acgtatattgacccggtcggcgtggcgaccatcggctatggccatacgggcgaccacgcg
atccccggcaatacgatcaccgaggcgcaggcccttgagatcctggaagaggatctgtcc
ggccacgtggcgtccgtcaggaaacacaccgacatcgcggtggagcagcatcagttcgac
gccctcgtctcctttgccttcaacgtcggaaacctcgcctatttcaactcgaccctgcgc
aggctgctgaatgaccgcgaccgcaacggggcggcggatcagttcctgcgctgggacaag
ggcacggtggacggccgaaagatcgtgctgccgggcctgagccgtcgccgcaaggcggag
cggcatctgttcaacaccggagaggtcgatttctttgacggccacggggtgcagacggtc
gcgcccgatcccgcatccccctccgatacgccgccagaacccgcaccgcagccgaccccc
acgccggtgccgcgtccgacgccaaatgccacctcgccccatcaatacgccgctgacctc
aacgcgacgctcgtggcctggggcgtgacacatttcaacgccgccgaattgatggagatg
ggcgcgtccaacgccaccccgggaagccccgcctatggcaccaacgcgctgccgccgcgc
gacgtgtgggacaatatgcggcgcaccatccagatgcttgatcggctgcgggaggtgctg
gatcagccgatccacatcctctcgggctatcgcagcccggcctacaaccagcttgtgggg
ggcgtgcccaacagcctgcatgtccagttcaacgcgattgatttctacgttggcggggcc
acgcgtccggcccattgggcggcggttctcaaggacatgcgcgtggccggagagttcagg
ggcggcatcgggatctacagcagtttcgtgcatatcgacacgcggggtcagaacgcggat
tggtaa

DBGET integrated database retrieval system