KEGG   Jannaschia sp. CCS1: Jann_2321Help
Entry
Jann_2321         CDS       T00330                                 

Definition
(GenBank) glycoside hydrolase family 24
  KO
K01185  lysozyme [EC:3.2.1.17]
Organism
jan  Jannaschia sp. CCS1
Brite
Enzymes [BR:jan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.17  lysozyme
     Jann_2321
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M15_3 Phage_lysozyme Peptidase_M15_2 DEC-1_N
Motif
Other DBs
NCBI-ProteinID: ABD55238
JGI: Jann2321
UniProt: Q28PX4
Position
complement(2324353..2325378)
Genome map
AA seq 341 aa AA seqDB search
MHISHLGLSLIKHFEGQYLTTYIDPVGVATIGYGHTGDHAIPGNTITEAQALEILEEDLS
GHVASVRKHTDIAVEQHQFDALVSFAFNVGNLAYFNSTLRRLLNDRDRNGAADQFLRWDK
GTVDGRKIVLPGLSRRRKAERHLFNTGEVDFFDGHGVQTVAPDPASPSDTPPEPAPQPTP
TPVPRPTPNATSPHQYAADLNATLVAWGVTHFNAAELMEMGASNATPGSPAYGTNALPPR
DVWDNMRRTIQMLDRLREVLDQPIHILSGYRSPAYNQLVGGVPNSLHVQFNAIDFYVGGA
TRPAHWAAVLKDMRVAGEFRGGIGIYSSFVHIDTRGQNADW
NT seq 1026 nt NT seq  +upstreamnt  +downstreamnt
atgcatatcagtcatttgggattgtccctgatcaagcatttcgaaggtcagtatttgacc
acgtatattgacccggtcggcgtggcgaccatcggctatggccatacgggcgaccacgcg
atccccggcaatacgatcaccgaggcgcaggcccttgagatcctggaagaggatctgtcc
ggccacgtggcgtccgtcaggaaacacaccgacatcgcggtggagcagcatcagttcgac
gccctcgtctcctttgccttcaacgtcggaaacctcgcctatttcaactcgaccctgcgc
aggctgctgaatgaccgcgaccgcaacggggcggcggatcagttcctgcgctgggacaag
ggcacggtggacggccgaaagatcgtgctgccgggcctgagccgtcgccgcaaggcggag
cggcatctgttcaacaccggagaggtcgatttctttgacggccacggggtgcagacggtc
gcgcccgatcccgcatccccctccgatacgccgccagaacccgcaccgcagccgaccccc
acgccggtgccgcgtccgacgccaaatgccacctcgccccatcaatacgccgctgacctc
aacgcgacgctcgtggcctggggcgtgacacatttcaacgccgccgaattgatggagatg
ggcgcgtccaacgccaccccgggaagccccgcctatggcaccaacgcgctgccgccgcgc
gacgtgtgggacaatatgcggcgcaccatccagatgcttgatcggctgcgggaggtgctg
gatcagccgatccacatcctctcgggctatcgcagcccggcctacaaccagcttgtgggg
ggcgtgcccaacagcctgcatgtccagttcaacgcgattgatttctacgttggcggggcc
acgcgtccggcccattgggcggcggttctcaaggacatgcgcgtggccggagagttcagg
ggcggcatcgggatctacagcagtttcgtgcatatcgacacgcggggtcagaacgcggat
tggtaa

DBGET integrated database retrieval system