KEGG   Jannaschia sp. CCS1: Jann_2455Help
Entry
Jann_2455         CDS       T00330                                 

Definition
(GenBank) 1-deoxy-D-xylulose 5-phosphate reductoisomerase
  KO
K00099  1-deoxy-D-xylulose-5-phosphate reductoisomerase [EC:1.1.1.267]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00900  Terpenoid backbone biosynthesis
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01130  Biosynthesis of antibiotics
Module
jan_M00096  C5 isoprenoid biosynthesis, non-mevalonate pathway
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Jann_2455
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.267  1-deoxy-D-xylulose-5-phosphate reductoisomerase
     Jann_2455
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DXPR_C DXP_reductoisom DXP_redisom_C Semialdhyde_dh TruB-C_2
Motif
Other DBs
NCBI-ProteinID: ABD55372
JGI: Jann2455
UniProt: Q28PJ0
Position
complement(2449022..2450203)
Genome map
AA seq 393 aa AA seqDB search
MSPRPEKRRVSIFGATGSIGQNTIDLIARAPEAYDVVALTGARNIAQLAADARRLSASIA
VTAEEELLPDLRAALEGSGVEAAAGEAALLEAADRPADWIMSAIVGAAGLAPGFRALRHG
TTLALANKESLVTAGPLLLAEAATHGATILPVDSEHSAVFQALVGEDIAAVERIIITASG
GGLRDWPEDDLARATPADAGAHPNWDMGQRITIDSASMFNKAMELIETKEFFGVSPARIE
AVVHPQSLIHALVGFTDGALMAHLGPPDMRHAIGYALNYPDRAHLPVDRLDLAQIARLEF
HAPSDTRYPALKIAREVMQTGGQSGCIFNAAKEIALDGFLAGKIGFMDMSGIVSDTLDAM
SSKNSLSNAPETLEDVLQTDQMARNIASARLAR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
gtgagcccccggcccgagaagcggcgggtcagcattttcggggccaccggctccatcggc
cagaacaccattgatctgatcgcccgcgcgccggaggcctatgatgttgtggcgctgacc
ggcgcgcgcaacatcgcccaacttgccgcagatgcgaggaggctttcggcgagtatcgcc
gtaacagccgaggaggagctgctgcccgatctgcgcgcagcgctggagggatccggggtg
gaggccgccgcaggcgaggccgcgctgctggaggccgctgaccgtcctgccgactggatc
atgtctgccattgtcggggccgccggccttgcccccggcttccgggcgctgcgccacggc
acgacgcttgcattggcgaacaaggaaagtctggtgacggccgggccgctcttgctggct
gaggctgcgacacacggggccacgatcctacccgtggacagtgaacattccgccgttttt
caagcgcttgtcggcgaagatatcgccgccgttgagcgtatcatcatcactgcatccggc
ggtggcctgcgcgattggccggaggatgatctggcccgcgccaccccagcggatgcaggc
gcgcatccgaattgggatatgggccaacggatcactattgattcagcctccatgtttaac
aaagccatggagctgattgaaacgaaagagtttttcggcgtttcacccgcaaggatcgag
gccgtggtccatccccaatcgctgatccacgcccttgtgggcttcaccgacggcgcgctg
atggcgcatctcgggccgccggatatgcgccacgccatcggatatgcgctgaactacccc
gaccgcgcgcatctgcctgtcgaccgccttgacctggcccagatcgcccggctggagttt
catgccccctccgatacccgatatccggcccttaaaatcgcccgcgaggtgatgcagacg
ggcggtcaatcgggctgcatcttcaacgccgcaaaggaaatcgcgctggatgggttcctg
gccgggaaaatcgggttcatggacatgtcaggcatcgtttccgacacactcgacgctatg
tcgtcaaagaacagcctttcaaatgccccagaaacccttgaggacgtgctgcaaactgac
caaatggctaggaacatagccagcgcgcgcctggcgcgataa

DBGET integrated database retrieval system