KEGG   Jannaschia sp. CCS1: Jann_2564Help
Entry
Jann_2564         CDS       T00330                                 

Gene name
cheR
Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB with PAS/PAC sensor
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan02020  Two-component system
jan02030  Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:jan00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Jann_2564 (cheR)
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Jann_2564 (cheR)
Enzymes [BR:jan01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Jann_2564 (cheR)
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Jann_2564 (cheR)
Two-component system [BR:jan02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Jann_2564 (cheR)
Bacterial motility proteins [BR:jan02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Jann_2564 (cheR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheB_methylest CheR PAS_3 PAS_4 CheR_N PAS PAS_9 PAS_10 Fez1 FapA Atg14 DUF812 Exonuc_VII_L Golgin_A5 Spc7 IncA TPR_MLP1_2 DUF1192 SnoaL_3 DUF1189 TMF_TATA_bd HAUS-augmin3 FAM76
Motif
Other DBs
NCBI-ProteinID: ABD55481
JGI: Jann2564
UniProt: Q28P81
Position
2567047..2570316
Genome map
AA seq 1089 aa AA seqDB search
MANAETSHDTSPHPANDPPFFVGIGSSAGGLEAVSTLAQNLSPDVNAVYVLAQHMSPTHK
SLLTALISRETPLPVVELKDDTTPVANTIFITPPNTDVILEDGKLRLVDPSGHPASPKPS
ADRLFKSLAREAGEHCVGVVLSGTGSDGSYGVQAIREAGGITIAQDVTTAKYDGMPQSAT
ETGCIDLTLSPEQIGVHLSKILASPRDFDQLRRLNERPSKMSDLFQILLARTNVDFRDYK
ENTVARRINRRMAALDIDDYDNYVAYCRTSGEEVEALYRDLLISVTRFFRDQNQFEQLRA
EFQQMVEGKDLGQLRIWVAGCATGEEVYSIAIILAEAMGGIDRLKKSRVQIFATDIDDRA
LEVARRGSYPITAAADIPDQFLEKYFNVLDGRIEVVSELRAVTLFSMHNIFHDPPFLNVD
FVSIRNVMIYFNTSLQNRVLHRIHYALNADGMLFLGTSETVGNMESLFEMRSGGDKIFSK
RRISGGNPPRFEMGNAGYGRKAPPQQYSSRAETNANTNSNRQVLDTGMFDMLARSVAPNG
FIVTRGGEMVRVFGDISHLTQLTENAPLWIGIRNLRKPLGDEIQGLIATAMKTKERRVGR
WHDISGPDFNQARSVCFPLPGVDTGEDHLLVALETRTKDAQIAKVETLSGDEQQTYIRQM
ELEVAQTREALQQTVEELQTTNEELQSINEEMQSTNEELQATNEELETSNEELQSTNEEL
ITVNEELQVNSAELQRVSTELAATLEVVPFPVLVIDQALIVRRASQAAMSQFNIGDLPAT
GFHLSQCRLPDEMSSLASICNEVFKFRAERSVVFNDGRTVKQLSVMPFRNQSDDVMGVVA
TVVDDISTGEAIDLLQRFGNIGHWQLDLTSMKMFWSDEIYTIHGMDPDDKMPSLEDAIGF
YHPDDRAEVQRLVERCIETGEPYQFTLRLIRANGHTVVVEAAGSRILNAEGEPARLIGIF
RNVTERTHKAHLMEQIEEIQSELGMAFYSYDLINDLPYWSSGLYTLLGYDTTDRPTSAKG
MIDLFHHDDRERLQALWDNAIETSEPYSFEARLIGAEGKILECVGEGKAATDDNGVATHM
FGRFQLTNS
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcagagacgtcgcacgacacgtccccacaccccgccaatgatccgccgttt
ttcgtgggcatcggatcgtcggccggcgggttggaggcggtgtcgaccctggcgcagaac
ctctcgccggatgtgaacgccgtctatgtcctggcgcagcatatgtcgcccacccacaag
agcctgttgaccgccctgatctcgcgtgagacgcctttgccggtggtggagctgaaagac
gacacgacgcctgtggcgaacacgattttcatcaccccgcctaacactgacgtgatcctg
gaagacggcaaactgcgccttgtggacccgtccggccaccccgcctcccccaaaccctcc
gccgaccgtctgttcaagtcgttggcccgcgaagccggcgagcattgcgtgggcgtcgtg
ctgtctggcaccggcagcgatggcagctacggcgtccaggccatccgcgaggccggcggc
atcaccatcgcccaggacgtcacgaccgcgaaatacgatggcatgccccaatcggcgacg
gagacgggctgcatcgacctgaccctctcgccggaacagatcggcgtgcatctgtcaaag
atcctcgccagcccccgggatttcgaccagctccgccgccttaatgagcgtcccagcaag
atgtcggacctgttccagatccttctggcacgcaccaatgtggatttccgggactacaag
gaaaacaccgtggcgcggcggatcaaccggcgcatggcggccctcgatattgatgattac
gacaattacgtcgcctattgccggacctcaggcgaagaggtggaggcgctttaccgcgat
ctcctgatctcggtcacgcggttcttccgcgatcagaaccagtttgaacagttgcgcgcc
gaattccagcagatggtggaaggcaaggatctgggtcagctgcgcatctgggtggcgggc
tgtgcgaccggggaagaggtctattccatcgcgatcatcctggccgaagcgatgggcggg
attgaccggttgaaaaagtcgcgggtgcagatctttgccaccgacattgacgaccgcgcc
ctggaagtggcgcggcgcggcagctatccgatcaccgccgccgccgatatcccagatcag
ttccttgagaagtatttcaacgtcctggatggccgcatcgaagtggtgtcggaactgcgc
gccgtcacgctcttttccatgcacaacatctttcacgatccacccttcctgaacgtggat
ttcgtctccatccgcaacgtgatgatctacttcaacacgtcgctgcaaaaccgcgtgctg
caccgcattcactacgctttgaacgctgacgggatgctgtttctgggcacgtcggagacg
gtcggcaacatggaaagcctgttcgagatgcgctcgggcggggacaagatcttctccaag
cgtcggatcagcggcggcaatccgccccgctttgaaatgggcaatgcaggctatggccgc
aaagcgcccccgcagcagtatagctcccgcgctgaaaccaatgccaacaccaattccaac
cgtcaggtgctcgacaccggcatgttcgacatgctcgcgcggtccgtggcgcccaacggc
tttatcgtgacccgcggcggcgaaatggtgcgtgtgttcggtgatatctctcacctcacg
caactgacggaaaatgccccgctttggatcggcatccgcaatctgcgcaaacctctgggg
gatgagatccaggggctgatcgccaccgcgatgaagacgaaagagcggcgcgtggggcgc
tggcacgacatttccgggcccgatttcaaccaggcccgcagcgtctgcttccccctgccc
ggcgtggataccggcgaagatcaccttctggtggctttggagacgcgcaccaaggacgcc
cagatcgccaaggtcgaaaccctctcgggcgatgaacagcaaacctatatccgccagatg
gaacttgaggtcgcccagacccgcgaggccctgcaacagaccgtggaagagctgcaaacc
accaacgaagaactgcaatccatcaacgaagagatgcaatccacgaacgaggaattgcag
gccaccaatgaggagctggaaacctccaacgaagagctgcaatccaccaacgaagagctg
atcaccgtgaacgaggaattgcaggtcaattccgccgaattgcagcgtgtctcaaccgaa
ctggccgcgacgctggaggttgtgcccttccccgttctcgtgatcgaccaggcgctgatc
gtccgccgcgcctcgcaggcggcgatgtcgcaattcaacatcggtgacctgccggccacg
ggcttccatctgtcccaatgcagattgcccgacgagatgtcgtccctcgcatccatctgc
aacgaagtgttcaagttccgcgccgaacgcagcgtcgtgttcaacgatggccgcacggtc
aaacagttgtcggtcatgccgttccgaaaccagtccgacgatgtcatgggcgtggtggcg
acggtggtggatgatatctccaccggtgaggccatcgacctgctgcaacgctttggaaac
attggccattggcagctggacctgacgtcgatgaagatgttctggtccgacgaaatctac
acgatccacgggatggatcccgacgacaagatgccgtcgctggaggacgccatcgggttc
taccaccccgacgaccgcgccgaagtgcaacgcctggtggagcgctgcatcgagaccgga
gagccgtatcaatttacgctgcgcctgatccgggccaacggccatacggtcgtggtggag
gcagcgggcagccggatcctgaatgccgaaggagagcccgcgcgcctgatcgggattttc
cgcaacgtcaccgaacgcacccataaggcccatctgatggagcagatagaagagatccag
agcgagttgggcatggccttctactcctacgatcttataaatgatctcccttactggagc
tcaggtctttacacgttgttaggatatgacacgaccgatcgtcccacctcggccaaaggt
atgatcgacctgttccaccatgacgaccgtgaacgcctgcaagcgctgtgggataacgcg
attgaaacctctgagccctatagcttcgaggcccgcctgatcggcgccgaagggaagatc
ctggaatgcgtcggtgagggcaaggccgccacggatgacaacggcgtcgcaacgcatatg
tttggccggttccagctaacaaactcttga

DBGET integrated database retrieval system