KEGG   Jannaschia sp. CCS1: Jann_2564Help
Entry
Jann_2564         CDS       T00330                                 

Definition
MCP methyltransferase/methylesterase
Orthology
K13924  
two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
jan  Jannaschia sp. CCS1
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:jan02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:jan02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2567047..2570316
Genome map
AA seq 1089 aa AA seqDB search
MANAETSHDTSPHPANDPPFFVGIGSSAGGLEAVSTLAQNLSPDVNAVYVLAQHMSPTHK
SLLTALISRETPLPVVELKDDTTPVANTIFITPPNTDVILEDGKLRLVDPSGHPASPKPS
ADRLFKSLAREAGEHCVGVVLSGTGSDGSYGVQAIREAGGITIAQDVTTAKYDGMPQSAT
ETGCIDLTLSPEQIGVHLSKILASPRDFDQLRRLNERPSKMSDLFQILLARTNVDFRDYK
ENTVARRINRRMAALDIDDYDNYVAYCRTSGEEVEALYRDLLISVTRFFRDQNQFEQLRA
EFQQMVEGKDLGQLRIWVAGCATGEEVYSIAIILAEAMGGIDRLKKSRVQIFATDIDDRA
LEVARRGSYPITAAADIPDQFLEKYFNVLDGRIEVVSELRAVTLFSMHNIFHDPPFLNVD
FVSIRNVMIYFNTSLQNRVLHRIHYALNADGMLFLGTSETVGNMESLFEMRSGGDKIFSK
RRISGGNPPRFEMGNAGYGRKAPPQQYSSRAETNANTNSNRQVLDTGMFDMLARSVAPNG
FIVTRGGEMVRVFGDISHLTQLTENAPLWIGIRNLRKPLGDEIQGLIATAMKTKERRVGR
WHDISGPDFNQARSVCFPLPGVDTGEDHLLVALETRTKDAQIAKVETLSGDEQQTYIRQM
ELEVAQTREALQQTVEELQTTNEELQSINEEMQSTNEELQATNEELETSNEELQSTNEEL
ITVNEELQVNSAELQRVSTELAATLEVVPFPVLVIDQALIVRRASQAAMSQFNIGDLPAT
GFHLSQCRLPDEMSSLASICNEVFKFRAERSVVFNDGRTVKQLSVMPFRNQSDDVMGVVA
TVVDDISTGEAIDLLQRFGNIGHWQLDLTSMKMFWSDEIYTIHGMDPDDKMPSLEDAIGF
YHPDDRAEVQRLVERCIETGEPYQFTLRLIRANGHTVVVEAAGSRILNAEGEPARLIGIF
RNVTERTHKAHLMEQIEEIQSELGMAFYSYDLINDLPYWSSGLYTLLGYDTTDRPTSAKG
MIDLFHHDDRERLQALWDNAIETSEPYSFEARLIGAEGKILECVGEGKAATDDNGVATHM
FGRFQLTNS
NT seq 3270 nt NT seq  +upstreamnt  +downstreamnt
atggccaacgcagagacgtcgcacgacacgtccccacaccccgccaatgatccgccgttt
ttcgtgggcatcggatcgtcggccggcgggttggaggcggtgtcgaccctggcgcagaac
ctctcgccggatgtgaacgccgtctatgtcctggcgcagcatatgtcgcccacccacaag
agcctgttgaccgccctgatctcgcgtgagacgcctttgccggtggtggagctgaaagac
gacacgacgcctgtggcgaacacgattttcatcaccccgcctaacactgacgtgatcctg
gaagacggcaaactgcgccttgtggacccgtccggccaccccgcctcccccaaaccctcc
gccgaccgtctgttcaagtcgttggcccgcgaagccggcgagcattgcgtgggcgtcgtg
ctgtctggcaccggcagcgatggcagctacggcgtccaggccatccgcgaggccggcggc
atcaccatcgcccaggacgtcacgaccgcgaaatacgatggcatgccccaatcggcgacg
gagacgggctgcatcgacctgaccctctcgccggaacagatcggcgtgcatctgtcaaag
atcctcgccagcccccgggatttcgaccagctccgccgccttaatgagcgtcccagcaag
atgtcggacctgttccagatccttctggcacgcaccaatgtggatttccgggactacaag
gaaaacaccgtggcgcggcggatcaaccggcgcatggcggccctcgatattgatgattac
gacaattacgtcgcctattgccggacctcaggcgaagaggtggaggcgctttaccgcgat
ctcctgatctcggtcacgcggttcttccgcgatcagaaccagtttgaacagttgcgcgcc
gaattccagcagatggtggaaggcaaggatctgggtcagctgcgcatctgggtggcgggc
tgtgcgaccggggaagaggtctattccatcgcgatcatcctggccgaagcgatgggcggg
attgaccggttgaaaaagtcgcgggtgcagatctttgccaccgacattgacgaccgcgcc
ctggaagtggcgcggcgcggcagctatccgatcaccgccgccgccgatatcccagatcag
ttccttgagaagtatttcaacgtcctggatggccgcatcgaagtggtgtcggaactgcgc
gccgtcacgctcttttccatgcacaacatctttcacgatccacccttcctgaacgtggat
ttcgtctccatccgcaacgtgatgatctacttcaacacgtcgctgcaaaaccgcgtgctg
caccgcattcactacgctttgaacgctgacgggatgctgtttctgggcacgtcggagacg
gtcggcaacatggaaagcctgttcgagatgcgctcgggcggggacaagatcttctccaag
cgtcggatcagcggcggcaatccgccccgctttgaaatgggcaatgcaggctatggccgc
aaagcgcccccgcagcagtatagctcccgcgctgaaaccaatgccaacaccaattccaac
cgtcaggtgctcgacaccggcatgttcgacatgctcgcgcggtccgtggcgcccaacggc
tttatcgtgacccgcggcggcgaaatggtgcgtgtgttcggtgatatctctcacctcacg
caactgacggaaaatgccccgctttggatcggcatccgcaatctgcgcaaacctctgggg
gatgagatccaggggctgatcgccaccgcgatgaagacgaaagagcggcgcgtggggcgc
tggcacgacatttccgggcccgatttcaaccaggcccgcagcgtctgcttccccctgccc
ggcgtggataccggcgaagatcaccttctggtggctttggagacgcgcaccaaggacgcc
cagatcgccaaggtcgaaaccctctcgggcgatgaacagcaaacctatatccgccagatg
gaacttgaggtcgcccagacccgcgaggccctgcaacagaccgtggaagagctgcaaacc
accaacgaagaactgcaatccatcaacgaagagatgcaatccacgaacgaggaattgcag
gccaccaatgaggagctggaaacctccaacgaagagctgcaatccaccaacgaagagctg
atcaccgtgaacgaggaattgcaggtcaattccgccgaattgcagcgtgtctcaaccgaa
ctggccgcgacgctggaggttgtgcccttccccgttctcgtgatcgaccaggcgctgatc
gtccgccgcgcctcgcaggcggcgatgtcgcaattcaacatcggtgacctgccggccacg
ggcttccatctgtcccaatgcagattgcccgacgagatgtcgtccctcgcatccatctgc
aacgaagtgttcaagttccgcgccgaacgcagcgtcgtgttcaacgatggccgcacggtc
aaacagttgtcggtcatgccgttccgaaaccagtccgacgatgtcatgggcgtggtggcg
acggtggtggatgatatctccaccggtgaggccatcgacctgctgcaacgctttggaaac
attggccattggcagctggacctgacgtcgatgaagatgttctggtccgacgaaatctac
acgatccacgggatggatcccgacgacaagatgccgtcgctggaggacgccatcgggttc
taccaccccgacgaccgcgccgaagtgcaacgcctggtggagcgctgcatcgagaccgga
gagccgtatcaatttacgctgcgcctgatccgggccaacggccatacggtcgtggtggag
gcagcgggcagccggatcctgaatgccgaaggagagcccgcgcgcctgatcgggattttc
cgcaacgtcaccgaacgcacccataaggcccatctgatggagcagatagaagagatccag
agcgagttgggcatggccttctactcctacgatcttataaatgatctcccttactggagc
tcaggtctttacacgttgttaggatatgacacgaccgatcgtcccacctcggccaaaggt
atgatcgacctgttccaccatgacgaccgtgaacgcctgcaagcgctgtgggataacgcg
attgaaacctctgagccctatagcttcgaggcccgcctgatcggcgccgaagggaagatc
ctggaatgcgtcggtgagggcaaggccgccacggatgacaacggcgtcgcaacgcatatg
tttggccggttccagctaacaaactcttga

DBGET integrated database retrieval system