KEGG   Jannaschia sp. CCS1: Jann_2667Help
Entry
Jann_2667         CDS       T00330                                 

Definition
ATP-dependent DNA ligase
Orthology
K01971  
DNA ligase (ATP) [EC:6.5.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Base excision repair
Nucleotide excision repair
Mismatch repair
Brite
KEGG Orthology (KO) [BR:jan00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Jann_2667
   03420 Nucleotide excision repair
    Jann_2667
   03430 Mismatch repair
    Jann_2667
   03450 Non-homologous end-joining
    Jann_2667
Enzymes [BR:jan01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Jann_2667
DNA repair and recombination proteins [BR:jan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Jann_2667
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2677458..2679056
Genome map
AA seq 532 aa AA seqDB search
MKAFAALFTTLDQTTKTSVKTAALADYFRTAPEDDRIWTIALLSGRRPRRTITTTKLREW
AAERAGIPLWLFEACYPVVGDLSETIALVLPEPETRIDKSLSAWIATLRGLDNAEEDARK
AAILEAWNGLPPIERFVFNKLITGGWRMGVSQKLMTRALSKATDIDEAELTHRLMGDWSP
DTVSWDGLIEAPDPTTNLSRPYPFYLAYQLEGDAEDQGGVGDWVAERKWDGIRGQLIMRG
GERYLWSRGEDLMTDRFPEFAQLLDYLPSGTVLDGEVLAYDFVNNTPLSFNKLQPRIGRK
TVPKKLLAEAPCILMAYDLLEWQGADIRHRPLAERRALLEEATDNMPPDAPLRLSPRVEA
ESWDDLRAARAISRDIGAEGLMLKRLSAPYLAGRKKGDWWKWKVDPLTIDAVMIYAQAGS
GRRATLYTDFTFAVWNGPDLVPFTKAYSGLTDKEFREITAWVRKNTTDRFGPVRAVTPHH
VFEIAFEGIQPSPRHKSGVALRFPRMLRWRKDKPLEEANTLDDLNQMLEQYG
NT seq 1599 nt NT seq  +upstreamnt  +downstreamnt
atgaaggccttcgccgcccttttcacgacgctggatcagaccaccaagaccagcgtgaag
acggccgcgctggccgactatttccgcacggcgcccgaggatgaccggatctggaccatc
gcattgctttcgggccgacgtccgcgccgcaccatcaccaccacaaaactgcgcgaatgg
gcggcggagcgggcgggcattccgctgtggctgtttgaggcctgttatccggtcgtgggt
gacctgagcgagaccattgcccttgttttgccggagcccgagacccggatcgacaaaagc
ctgagcgcctggatcgccacgctgcgcggcctcgacaatgcggaggaggatgcgcgcaag
gccgcgattctggaggcctggaacggtctgcccccgatcgaacggtttgttttcaataag
ttgattaccggcggctggcgcatgggggtgagtcaaaagctgatgacccgcgcgctgtcg
aaggccactgacatcgatgaggcggaactgacacaccgcctgatgggcgattggtcgccc
gacacggtcagttgggacggcctgatcgaagcgcccgatccaacaacgaaccttagccga
ccctacccgttctatctggcttatcagctggagggcgacgcggaggaccagggaggcgtc
ggcgattgggtggcggagcggaaatgggacggcattcgcggccagctgatcatgcgcgga
ggcgagcgctatctgtggtcgcgtggcgaagacctgatgacggaccggttcccggagttt
gcgcagctgctggactacctgccctcggggacggttcttgacggcgaggttttggcgtat
gactttgttaacaacaccccgctttcgttcaataagttgcaaccgcgtatagggcgcaaa
actgtgcccaagaagcttctggccgaggccccgtgcatcctgatggcctatgatctgctg
gaatggcagggcgcggacattcggcacaggccgttggccgagcggcgcgctttgttggag
gaggccaccgacaatatgccacccgacgcccccctccgcctgtcgccgagggtggaggcc
gagagttgggacgacctgcgcgccgcacgcgccatcagccgcgacataggggcagagggg
ttgatgctgaagcgtctttcggcaccctatctagccgggcgcaaaaagggcgattggtgg
aaatggaaggtcgatccactgaccatcgacgcggtgatgatctatgcgcaggcgggttcc
ggccggcgggcaacgctctacaccgatttcacattcgcggtctggaacggccccgatctg
gtgcccttcaccaaggcctattccggcctcaccgacaaggaattccgcgagatcacggcc
tgggttcgcaagaacacgacggaccggttcggccccgtccgcgcggtcacgccgcaccat
gtgtttgagattgcgttcgaaggcattcaaccctcaccgcgccacaaatccggcgttgcc
ctgcgctttccccgcatgttgcgctggcgcaaagacaagccgttggaagaggccaataca
ttggacgacctcaaccagatgctggaacaatacggctaa

DBGET integrated database retrieval system