KEGG   Jannaschia sp. CCS1: Jann_2726Help
Entry
Jann_2726         CDS       T00330                                 

Definition
dihydropteroate synthase
Orthology
K00796  
dihydropteroate synthase [EC:2.5.1.15]
Organism
jan  Jannaschia sp. CCS1
Pathway
Folate biosynthesis
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Jann_2726
Enzymes [BR:jan01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.15  dihydropteroate synthase
     Jann_2726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2737445..2738455)
Genome map
AA seq 336 aa AA seqDB search
MTSYWRAIPSLDSARPPGALPLAGGWAWFDRLERLNRNGPSEVVAATEAPKDVLRRLCAP
RATLAGVSLDRPRLMGILNTTPDSFSDGGRFDAMPQAVEHARAMVRDGADLIDIGGESTR
PGASEIPADVEIARTAPVISALRGDGIAISLDTRKAAVAEAGLAAGAAILNDVSGLRFDA
RLADVAAQHGAPLVLMHSIATPQTMQAEAPTAYSDVLLDVYDGLEAAIAQARAVGVRRDQ
IIVDPGIGFGKTQDQNLDLIRRVSLFHSLGCGILLGVSRKGFIGTLGSEPDAARRGPGSA
AIGLWALGQGVQLLRVHDIALHRQAVALWWATHNAL
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaccagttattggcgcgccatcccaagccttgattcggcccgtccgcccggagccttg
ccgctggcaggcggatgggcgtggtttgatcgcctggagcgcctgaaccgtaacggcccg
tccgaggtcgttgccgcgacggaagcgcccaaggatgtcttgcgaagactatgcgcaccc
cgcgccacccttgcgggggtgtcgctggacaggccgcgtttgatggggatcctgaacaca
acgccagacagcttctcagatggtgggcgttttgatgccatgccgcaggctgttgagcac
gcccgtgccatggtccgcgacggggctgatcttattgatatcggaggagaatccacgcgc
cccggtgcgtcagagatcccagctgacgtggagattgcccgcacagcaccggtgatttca
gctcttcggggggacgggatcgcgatcagtctcgatacccgcaaagccgccgtggcagag
gccggattggccgcaggcgcagcgatcctgaacgatgtttccggcctgcgatttgacgcg
cgtcttgccgacgtggctgcacagcatggtgcaccgctggtcctgatgcactcgattgcc
acgccccaaaccatgcaggccgaggcgccgacggcctattccgatgttctcctggacgtc
tatgatgggttggaggctgccatcgcgcaggcccgggcagtcggtgtgcgtcgggaccag
atcatcgtcgaccccgggattggctttggaaagacgcaagaccagaaccttgatctgatc
cggcgcgtctccctgtttcacagtctcggctgcggtattctgcttggagtgtcccgcaag
gggttcatcggaacgctcgggtccgagccggacgccgcgaggaggggccccgggtcggcg
gccatcggcctatgggcattggggcagggcgttcaacttttgcgcgtccatgatatagcg
ttgcatagacaggcggtggccctttggtgggctactcacaacgcattgtaa

DBGET integrated database retrieval system