KEGG   Jannaschia sp. CCS1: Jann_2844Help
Entry
Jann_2844         CDS       T00330                                 

Definition
chemotaxis protein CheB
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
jan  Jannaschia sp. CCS1
Pathway
Two-component system
Bacterial chemotaxis
Brite
KEGG Orthology (KO) [BR:jan00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Jann_2844
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Jann_2844
Enzymes [BR:jan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Jann_2844
Two-component system [BR:jan02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Jann_2844
Bacterial motility proteins [BR:jan02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Jann_2844
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2860664..2861698
Genome map
AA seq 344 aa AA seqDB search
MKTGVVAAVKASVREYERVYHGLKPPLKTAIVLAGQGQRRALTSELKQDGRFVIVGEFGS
LGESYADIEAQSPDVTICTKALTDLPEFHMFAAMLRMVGSTLITVEDRDCARRVTRLLGL
PKNVGASPVATPMPHTPPPDRSSLTADTRGAPQRLVAIGASTGGIEALAQVLASYPILCP
PTVIVQHIKPDYLASVVQRLDRVCPAKVVAASHHLPIRPGQVVFAPGQPLHLEVQHRSMR
CVLSDAPPVSGHRPSIDVLFHSLVPLNHKAVGVILTGMGRDGAEGMGAMRRAGAWTIAQD
AATSTVHGMPRVAAEQGAACQVLPLQKISKAILAAATAHEDASS
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
ttgaagacaggcgttgtggcggcggtcaaggcctcggtaagggaatacgaaagagtgtac
cacgggctgaagccaccgctgaaaaccgcaattgtgcttgcggggcaaggccagcgcagg
gcgttgacctcggagctgaagcaggacgggcggtttgtaatcgtcggggagtttgggtca
ctcggcgaaagctacgcggacattgaagcgcagtcgcccgatgtcacgatatgcaccaag
gccctgaccgacttgcccgaatttcacatgtttgcggccatgttgcggatggttggcagc
accttgatcacggtcgaggacagagattgcgcaagacgggtgacgcgcctgcttggcctg
ccgaaaaacgtcggcgcaagccccgttgcaaccccgatgccgcacacgccgccgccagat
cgctcttcgctgacggccgacacccgcggggcgccgcagcgtctggtcgccatcggggcc
tccaccggcgggatcgaagcgctggcgcaggtcctggcaagctaccccatcctgtgcccg
cccactgtcatcgtgcagcacatcaagccagactatcttgcatccgtggtgcagcggctg
gatcgcgtctgccctgccaaggtcgtggccgcctcccatcatctgcccatccggccgggc
caggttgtgtttgctccgggccagcctctgcatcttgaggttcagcaccgctccatgcgc
tgtgtgctgagcgacgcgcccccggtatccggtcaccgcccatccatcgacgtgctgttt
cacagcttggtgcccctcaaccacaaggcggtcggcgtgatcctgacgggcatgggtcgc
gatggcgccgagggtatgggggccatgcggcgggcgggtgcatggacgattgcgcaggat
gcggcaacgtcgaccgttcatggcatgccacgggtcgccgcggaacagggggccgcgtgc
caggtcctgccgctacagaaaatttccaaggcgatcttggccgccgccacagcccatgag
gacgccagcagttga

DBGET integrated database retrieval system