KEGG   Jannaschia sp. CCS1: Jann_2886Help
Entry
Jann_2886         CDS       T00330                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
jan  Jannaschia sp. CCS1
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:jan00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:jan00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2906103..2907365)
Genome map
AA seq 420 aa AA seqDB search
MDRIVVKGSGPLSGQIPIAGAKNTCLKLMCAALLSDEPLTLTNVPRLSDVATLSELLESL
GVQIGRLDDGQTLAFSANTLTSQLAHYDIVRKLRASFNVLGPLLGRTGQAVVSLPGGCAI
GARAVDFHITGLEAMGAKIELKDGYVHAAGDLKGAEIEFPFPSVGATENVMCAAVRAKGT
TVIKNAAREPDTKALADCLIAMGADIEGAGTETMIVRGVDRLHGATHRVIADRIEMGTYM
CAPGIAGGEVECLGGTRALVASLCDKMEAAGLEITETDAGLKVRHPGGRLKAVDVATAPF
PGFPTDLQAQFMAMMCFADGTSVLEETIFENRFMHAPELIRMGASIDVQGNTARVTGVDR
LRGAPVMATDLRASVSLILAGLAADGETTVNRVYHLDRGYEHLVRKLRGVGANVERLSDG
NT seq 1263 nt NT seq  +upstreamnt  +downstreamnt
atggacaggatcgttgtgaagggctcgggcccgttaagtggccaaatcccgattgcgggg
gcgaaaaacacctgcctgaagctgatgtgtgccgcgcttttgagtgatgagccgctgacg
ctgaccaatgtcccgcgtctctcggacgtggccacgctgagcgagcttctcgaaagtctc
ggtgtgcagatcgggcggctggatgacggccagacgctggcgttttcggccaacacgctg
acctctcagctggcccattatgacatcgtgcgcaagctccgcgcctccttcaacgtattg
ggcccgcttctgggccgcacggggcaggcggtcgtgtcgctgcccggcgggtgcgccatc
ggggcccgtgccgttgatttccacatcaccggccttgaggcgatgggcgcgaagattgag
ttgaaagacggctacgtccatgccgcgggcgacctgaagggggcggagatcgaatttccc
ttcccctccgtgggcgcgaccgaaaacgtcatgtgcgccgccgtgcgcgccaagggcaca
acggtcatcaagaacgccgcgcgggagccggataccaaggcgctggccgattgtctgatc
gccatgggcgcggatatcgaaggggcagggaccgaaaccatgatcgtgcgcggtgtcgac
cgtctgcacggcgccacccatcgcgtcatcgctgaccggatcgaaatgggcacttacatg
tgcgcccccggcatcgcgggcggcgaggttgaatgcctcggcggcacccgtgcgctggtc
gcctcgctctgtgacaagatggaagcggcggggctggagatcactgaaaccgacgcgggc
ctcaaggttcgtcatcccggcgggcggttgaaggccgtcgacgtcgccaccgcgccgttc
ccgggcttccccaccgatttgcaggcgcaattcatggcgatgatgtgctttgccgacggc
acgtctgtgctggaagagacgatattcgagaaccgcttcatgcatgccccggagctgatc
cgcatgggcgccagcatcgacgtgcagggcaataccgcccgcgtcaccggcgtggatcgt
ctgcgcggtgcgcctgtgatggcgacggatctgcgggcctcggtgtcgctcatcctcgcg
ggcctcgccgccgatggggaaaccacagtgaaccgcgtctaccacctggatcgtggctat
gaacacctggtccgcaaactgcgcggtgtcggcgcgaatgtggagcggctgtccgatggc
taa

DBGET integrated database retrieval system