KEGG   Jannaschia sp. CCS1: Jann_2977Help
Entry
Jann_2977         CDS       T00330                                 

Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase
  KO
K01782  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase [EC:1.1.1.35 4.2.1.17 5.1.2.3]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00071  Fatty acid degradation
jan00280  Valine, leucine and isoleucine degradation
jan00281  Geraniol degradation
jan00310  Lysine degradation
jan00362  Benzoate degradation
jan00380  Tryptophan metabolism
jan00410  beta-Alanine metabolism
jan00640  Propanoate metabolism
jan00650  Butanoate metabolism
jan00903  Limonene and pinene degradation
jan00930  Caprolactam degradation
jan01040  Biosynthesis of unsaturated fatty acids
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
jan01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    Jann_2977
   00650 Butanoate metabolism
    Jann_2977
  Lipid metabolism
   00071 Fatty acid degradation
    Jann_2977
   01040 Biosynthesis of unsaturated fatty acids
    Jann_2977
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Jann_2977
   00310 Lysine degradation
    Jann_2977
   00380 Tryptophan metabolism
    Jann_2977
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    Jann_2977
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    Jann_2977
   00281 Geraniol degradation
    Jann_2977
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Jann_2977
   00930 Caprolactam degradation
    Jann_2977
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     Jann_2977
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     Jann_2977
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     Jann_2977
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N 3HCDH ECH_1 ECH_2 DAO NAD_binding_2 FAD_binding_3 NAD_binding_8 UDPG_MGDP_dh_N 2-Hacid_dh_C Pyr_redox_2 F420_oxidored Rossmann-like
Motif
Other DBs
NCBI-ProteinID: ABD55894
JGI: Jann2977
UniProt: Q28N18
Position
2994814..2997015
Genome map
AA seq 733 aa AA seqDB search
MTDFTMQTDADGVAVITWDVPGKSMNVLNRDAFDVVEELVDAALADETVKGIVITSGKSS
FAGGMDLNVLASIRAESGDNPAEGLFNFTMNGHRILRKIERAGMEPKTNKGGKPIACAIP
GTCAGIGTEIALACHRRFMADNPKAKMGLPEILVGLFPGAGGTTRYSRMVGAMAAAPVLL
EGRMLDPKKAKSAQLVDEVVPADELLSAAKDWVLNAAPADIVKPWDAKGYKMPGGAPYHP
AGFMTFVGANAMIHGKTKGVYPAAKALLSSIYEGALVDFDTALKIEARYFTQILMNPSSS
AMIRSLFINKQALEKGANRPSVPDQTVKKVGIIGAGMMGAGIAYVSALAGIEVVLIDAAQ
DSADRGKAYSEGLLDKGMKRGKVTEEKKAKVLGQITATTDYDALNGCDLIVEAVFEDPKV
KAEVTAKAEAAMNADGIFATNTSTLPITMLAKASSRAEQFIGIHFFSPVDKMALVEIIKG
KQTGDVAVAKALDFVRQIRKTPIVVNDERFFYANRCILPYVNEGVRMLQEGVAPALIENA
AKLVGMPLGPLQLTDETSIDLGAKIARATKAADPDYDDTTDELIFWMEEEGRLGRKANAG
FYSYDEKGKRQGLWDGLGARYAQADDQPELTDVQHRLLFAQVLEAVRALEAGVLMDIREG
DVGAILGWGFAPWSGGPFSWLDILGTPYAAERCDQLEAEFGPRFACPPLLREMADKGQSF
YGRFGEGVDSKAA
NT seq 2202 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatttcaccatgcagaccgacgccgatggcgttgctgtcatcacctgggacgtg
cccggaaaatccatgaatgtgctgaaccgggatgcctttgatgtcgtcgaagagttggtc
gatgcagcgctggccgatgagacggtcaagggcatcgtgatcacctccggcaagtcgtcc
tttgcggggggtatggacctcaatgtgctggcctcgatccgcgcggaaagcggcgacaac
ccggcggagggcctgttcaacttcacgatgaacggccaccgcatcctgcgcaagattgag
cgcgcggggatggagcccaagaccaacaagggtggcaagcccatcgcctgcgccattccg
ggcacctgtgcgggcatcggcacggagatcgcgctcgcctgccaccgccgtttcatggcg
gacaatcccaaggcgaagatgggcctgccggagatcctcgtgggccttttccccggcgcg
ggcggcaccacccgctattcgcgcatggtcggagccatggccgcagcgcctgtgctgctg
gagggccggatgctggacccgaagaaggccaagtccgctcaattggtggatgaggtcgtt
ccggcggacgagctgctgtctgctgccaaggactgggtcttgaacgcggcccccgcagac
atcgtgaagccgtgggacgccaaaggctacaagatgcccggcggcgcgccctaccatcct
gcggggttcatgacctttgtgggcgcgaacgcaatgatccacggcaagaccaaaggcgtc
tatccggccgccaaggcgcttttgtcgtcgatctatgagggcgcgttggtggatttcgac
acggcgctcaagatcgaggcgcggtatttcactcaaatcctgatgaacccctcgtcatcc
gcgatgatccggtcgctgttcatcaacaagcaagcgttggagaagggcgcgaaccgtcct
tccgttcccgatcagacggtcaagaaggtcggcatcatcggcgcaggcatgatgggcgcg
ggcattgcctatgtctcggccttggctggcattgaagtcgtgctgatcgacgccgcgcaa
gactctgcggatcgcggcaaagcctactcggaagggcttctcgacaaaggcatgaaacgc
ggcaaggtgacggaggagaagaaggccaaggtcctgggccagatcaccgccaccacggat
tatgatgcgctgaatggctgcgacctgattgtggaggccgtgtttgaagaccccaaggtc
aaggcagaggtgaccgcaaaggccgaagccgcgatgaatgcagacgggatctttgccacc
aacacctccaccctgcccattacgatgctggccaaggcatcgtcgcgcgcggagcaattc
atcggcatccacttcttctctccggtcgacaaaatggcgctggtggagatcatcaagggc
aaacaaaccggggatgtggccgtggccaaagcgctcgatttcgtgcgccagatccgcaag
acgcccatcgtcgtgaacgacgagcggttcttctacgccaaccgctgcatcctgccctac
gtcaatgagggcgtgcggatgttgcaggaaggcgtggcccctgccctgatcgagaacgcc
gccaaactggtcggcatgccgctgggtccgctgcaattgaccgacgagacatccattgac
ctcggcgccaaaatcgcccgcgccaccaaggccgccgacccggactatgacgacaccacc
gatgagctgatcttctggatggaagaggaagggcgcctgggtcgcaaggccaatgcgggc
ttctacagctatgatgagaagggcaagcggcagggcctctgggacggtctgggcgcgcgc
tacgctcaggccgatgatcagcccgagttgaccgacgtgcagcaccgcctcctgttcgcg
caggtgttggaggccgtccgcgcactggaggctggcgttctgatggacatccgcgaaggc
gacgtcggtgcgatcctgggatggggctttgcgccctggtccggtggtccgttctcctgg
ctcgacatcctgggcacgccctatgcggcggaacgctgcgaccaactggaggccgagttt
ggcccccgcttcgcctgcccgcccctgctgcgtgagatggccgacaaggggcaaagcttc
tacggccgcttcggcgagggtgtggacagcaaagcagcctga

DBGET integrated database retrieval system