KEGG   Jannaschia sp. CCS1: Jann_2986Help
Entry
Jann_2986         CDS       T00330                                 

Gene name
deoA
Definition
thymidine phosphorylase
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Jann_2986 (deoA)
Enzymes [BR:jan01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Jann_2986 (deoA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3005149..3006459)
Genome map
AA seq 436 aa AA seqDB search
MSDARAILTKLRQGDRLTEAEVFWFAEGLATGDVTDAQAGAFAMAVCQNGLGEEGRVQLT
RAMRETGRVMAWHLDGPVIDKHSTGGVGDCVSLLLAPALAACGAFVPMISGRGLGHTGGT
LDKLEAIPGYNTDVSPDDLQEIVADIGCAIVGASGDIAPADKRLYAVRDVTATVASVDLI
TASILSKKLAAGLEALVLDVKVGSGAFMGTEAEALGLAQALVATAQGAGCMTTALVTDMN
QPLASSAGNALELAEVMQVLTGAAKDTALEHLTVALGGEVLALGGLAADASDGEGRIRRA
LAGGEAARVFAEMVAELGGPVDFVERWPDRLPAAPVMMDVHPGQAGYVTAIDTRALGEIV
VHLGGGRLREDDRIDPAVGLSDIARLGTRVDDVTPLARMHTADEDEGRALAAKLRRAFTL
SDAAIDTPPLIHERIA
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
atgagcgacgcgcgcgccattctgacgaagctgcgccagggcgaccgcctgacggaggca
gaggtgttctggttcgccgaagggcttgcgaccggcgacgtcaccgacgctcaggcaggc
gcgtttgccatggccgtgtgccaaaacggactgggcgaggagggccgggtgcaactgacc
cgcgcgatgcgagagacgggccgcgtgatggcatggcacctcgacgggccggtgatcgac
aaacattcaacgggtggcgtaggggattgcgtgtcgctgctgctggcacctgcgctggcc
gcttgcggagcgttcgtgccaatgatttctgggcgcggtttggggcacacgggcggcacg
ctggataagttggaggccattccgggctacaacacagacgtctcccccgatgatctgcaa
gagatcgtggctgatatcggctgtgccatcgtgggcgcatcgggtgatatcgcgcccgct
gacaagcggctttacgcggtgcgggacgtgacggccaccgtcgcctcggtcgatctgatc
acggcgtcgatcctgtcaaaaaagctcgccgccgggttggaggcattggttctggatgtg
aaggtcggctcgggcgcgttcatgggcacggaggcggaggcgttgggcctggcgcaagcg
ctggtcgcgacggcacaaggcgcggggtgcatgaccacggcgttggtcaccgacatgaac
caacccctggccagcagcgcgggcaatgcgttggaactggccgaggtgatgcaggttttg
accggagcggcgaaggatacggccctggagcacctgaccgttgcattgggcggagaggtc
ctggccctgggcggtctggcggcggatgcgagcgatggcgagggccggatcagacgcgcg
ctggcaggcggagaggccgcgcgggtcttcgcagagatggtggccgaactgggcggcccg
gtcgatttcgtggagcgctggcccgacaggttgccggccgcgccggtgatgatggatgtg
catccgggacaggcgggatacgtcaccgccatcgacacccgcgccctgggagagatcgtg
gtgcatctgggcggcggccgcctgcgggaggacgaccggatcgacccggcggttggcctg
tcggacatcgcgcggctgggcacgcgggtggacgatgtgacaccccttgcgcgcatgcac
acagccgatgaggacgaaggccgcgcgctggccgccaagctgcgccgcgcattcaccctg
tcggacgctgcgatagatacgccgcccctgatccatgagaggattgcctga

DBGET integrated database retrieval system