KEGG   Jannaschia sp. CCS1: Jann_3090Help
Entry
Jann_3090         CDS       T00330                                 

Definition
PfkB protein
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
jan  Jannaschia sp. CCS1
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Jann_3090
Enzymes [BR:jan01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Jann_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3125150..3126079
Genome map
AA seq 309 aa AA seqDB search
MTYICVVGSINVDLTCYLPRWPDRGETISALRTQTGLGGKGANQAVAARRLGANVHLIGA
IGADPFGADCALALRQADITPHLMEATKTATGMALIDVGPSGDNIIRLAHGANYDLDLAF
LDQHRAVIEGCAVLLLQNEIPVEISIAAAQLAKAAGALVIMDPAPAPSAPWGPDVLHHFD
VITPNTHEAGLLLGSTPRTLADARVAAANLATMGPTGAIVTMGGDGVAWHVGADSGQMLP
PETAVIDTVGAGDCFNGALAAYLAKTQTISVAITAACAAASLSTRRAGAAASLPTLQEVQ
NLLDGLAVA
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
gtgacctacatttgtgtcgttggcagcatcaatgttgatctcacctgttatctgccgcgc
tggcctgatcgcggcgaaacgatctcggccttgaggacccagaccgggcttgggggcaaa
ggcgccaaccaggccgtggccgccagaagacttggcgctaacgtccatctgatcggcgcg
atcggcgcggacccattcggggcagattgcgccctcgcacttcgccaagccgacatcaca
ccgcacctgatggaagccacaaaaacggccaccggcatggcgctgattgatgtgggaccg
tcaggggacaatatcattcgcctggcccacggtgcgaattatgatctggaccttgcgttt
ctggatcaacaccgcgctgtgatcgaaggctgtgctgtgctgcttcttcaaaatgaaatt
ccagttgagatctcaattgctgcggcccaactggccaaggctgcgggcgctttggtgatc
atggatcccgcccctgccccatctgccccctggggaccggatgtcttgcaccatttcgat
gtcataacgcccaatacccatgaagccggcctgcttctgggatcgacgccccgcacactt
gcggatgcacgggtcgccgcagcgaacttggccacgatgggaccaaccggcgcgattgtg
acaatgggtggcgatggtgtcgcctggcatgtcggggcggacagcgggcaaatgctgccg
ccggagacagccgtcattgatacggtcggcgccggggactgcttcaatggtgcgcttgcg
gcctatctggccaagacccaaaccatctcagtcgccatcaccgctgcctgcgcggcggcc
agcctgtcaacacgccgggcgggtgccgcggcgtcgcttccgaccttgcaggaggtacag
aaccttcttgacgggctggcagttgcttga

DBGET integrated database retrieval system