KEGG   Jannaschia sp. CCS1: Jann_3149Help
Entry
Jann_3149         CDS       T00330                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jann_3149
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jann_3149
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Jann_3149
Enzymes [BR:jan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Jann_3149
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3189867..3191255)
Genome map
AA seq 462 aa AA seqDB search
MQYISTRGRAPVLSFEEAMLTGLARDGGLYVPAEIPQMSHGDIAAMAGLSYEDIAFRVMR
PFVGDTFSDDEFAGLIEAAYAGFGHAARAPLKQLQPNHFLLELFHGPTLAFKDFAMQLIG
QMFQAALTRRDDRVTIVGATSGDTGSAAMEAFRGLDAVDVFILFPHGRVSDVQRRQMTTV
TEANAHALALTGDFDDCQARLKDMFNHFEFRDRVRLAGVNSINWARVLAQVVYFFSSAVS
LGAPHRPISFCVPTGNFGDIFAGYIAKRMGLPIEKLVIATNQNDILHRAMVSGGYTTEGV
TPSISPSMDIQVSSNFERALFDAYDRDGDAVAQLMDELKSGDGFTISQGAIGRLRDTFDS
GRVSEEETSAMITRALPEMGELLCPHSAVGVDVAQDFLGATPLVTLATAHPAKFPDAVEA
ASGTRPELPARMGDLFDRPERVQRVENDLAALEQVIEGGIRP
NT seq 1389 nt NT seq  +upstreamnt  +downstreamnt
atgcaatacatctcgacccgcgggcgcgcgcctgttttgtcctttgaggaggccatgctg
accggccttgcgcgcgacggcggcctctatgtcccggccgagatcccgcagatgtcccac
ggggatatcgcggccatggcgggcttgtcctatgaagatatcgccttccgcgtgatgcgc
ccgttcgtgggcgacaccttcagcgacgatgaattcgcgggcctgatcgaggcggcttac
gcgggttttggccacgccgcccgcgcacctttgaaacagctgcaacccaaccacttcttg
ctggaactgttccacgggccgacattggcgttcaaagacttcgccatgcagctgatcggc
cagatgttccaggcggctttgacgcgacgcgacgatcgcgtgaccattgtcggcgcgacc
tcgggcgacaccggctctgcggcgatggaggcgtttcgcggccttgatgccgtcgacgta
ttcatcctcttcccccatggccgggtcagcgatgtgcaacgccgccagatgaccacggtg
acggaggccaacgcccacgcattggcgctgaccggggattttgacgattgccaggcgcgg
ctcaaggacatgttcaaccatttcgagttccgtgaccgggtgcgcctggccggggtcaac
tcgatcaactgggcccgcgtgctggcgcaggtcgtctatttcttctcctccgccgtgtcg
ttgggcgcgccgcaccggcccatctccttctgtgtgcccaccggcaatttcggcgatatt
ttcgcgggttacatcgccaagcgtatgggcctgccgattgagaaattggtcattgccacg
aaccagaacgacatcctgcaccgggcgatggtctcgggcgggtacacgacggaaggggtc
acgccgtcgatctctccatcgatggatattcaggtctcgtcgaactttgagcgcgcgctt
tttgacgcctatgatcgggatggcgatgcggtcgcacagctgatggatgaattgaaatcg
ggcgacgggttcacgatcagccaaggggcgattggccgcctgcgcgacaccttcgacagt
ggccgcgtgtcagaggaagagacctccgccatgatcacccgcgcgctgcccgagatggga
gagcttttgtgcccccattccgctgttggcgtggacgttgcgcaagatttccttggtgca
acgccacttgtcacactcgccaccgcacacccggccaagttccccgacgcggtcgaggca
gcctctggcacccggcccgaactgcctgcgcgcatgggcgatcttttcgacaggcccgaa
cgggtgcagcgggtggagaatgacctcgccgcgcttgagcaagtgattgaaggaggcatc
cgcccgtga

DBGET integrated database retrieval system