KEGG   Jannaschia sp. CCS1: Jann_3273Help
Entry
Jann_3273         CDS       T00330                                 

Definition
glutathione peroxidase
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Lipid metabolism
   00590 Arachidonic acid metabolism
    Jann_3273
  Metabolism of other amino acids
   00480 Glutathione metabolism
    Jann_3273
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     Jann_3273
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3327052..3327576
Genome map
AA seq 174 aa AA seqDB search
MDRRLFLSATAACLALGPARATQAFSFPSIDGGTYDLLAWRGQPLLVVNTASLCGFTGQY
DGLQRVHEAYAGRARVLAVPSDDFAQELGSEAEVAAFCEVNFGLTLPMTTIQPVRGPRAH
PFYRWLATAHRFTPQWNFNKVLLDADGALVATWGSRPEPMGRRIRSAIDGLLSA
NT seq 525 nt NT seq  +upstreamnt  +downstreamnt
atggaccgtcgcctgtttctgagtgccaccgccgcgtgccttgccctgggcccggcgcgg
gccacgcaagccttcagctttccatccattgatgggggcacctacgatttgctcgcctgg
cgggggcaaccgctgttggtggtcaacaccgcctcgctctgcgggttcacgggccagtac
gatggattgcaaagggtgcatgaggcctatgcgggccgcgcccgtgttttggcagtgccg
tcagatgatttcgcccaggaattgggcagcgaggcggaggtggccgcgttttgtgaggtc
aatttcgggctgaccctgccgatgaccacgatccaacccgtgcgcggaccccgggcgcat
ccgttctatcgctggctcgccaccgcccatcgcttcaccccgcaatggaatttcaacaag
gtgctgctggacgcagacggcgcattggtggccacctgggggtcgcgccccgagcccatg
ggtcgccgtatccgcagcgcgattgacgggcttctctctgcgtga

DBGET integrated database retrieval system