KEGG   Jannaschia sp. CCS1: Jann_3314Help
Entry
Jann_3314         CDS       T00330                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycerophospholipid metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Lipid metabolism
   00564 Glycerophospholipid metabolism
    Jann_3314
Enzymes [BR:jan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Jann_3314
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3368271..3369233
Genome map
AA seq 320 aa AA seqDB search
MLMTADITEPAPFYEAVAEGPANVAASWVRAADGTRLRMAVWPTPNQEGGSNGTVLMFPG
RTEYVEKYGRVASDLAENGYGMVAFDWRGQGLADRPPHRRDMGHVLTFDEYRQDVTAFLK
AMEPMNLPKPWFLIGHSMGGCIGLRALYDGLDVEAATFTGPMWGLQMSNLLRTLQPAITK
LAGPMGFGKTFAPTTGPWEPLEFEDNSLTTDRDQFDYMFRQTDVHPELALGGPSLSWVKA
ALWETEDLMEKTPLDLPALAIVGTGEQIVDVDAARTRMASWPKGSYLSIEGGRHEVLMEA
DPLRDQSLDAILALFRKAAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaccgctgacatcaccgagcccgcaccgttctacgaggctgtcgccgagggg
ccggccaatgtcgcggcctcctgggtgcgggcggcagatggcacgcgcctgcgcatggcg
gtctggcccaccccaaatcaagaaggcgggtccaacggcaccgtactgatgtttccgggc
cgcacggaatatgtcgagaaatatggccgcgttgccagtgatctggcagaaaacggctac
ggcatggtggcgttcgactggcgcggtcagggtctggcggatcgcccgccgcatcgccgc
gacatgggccatgtgctcaccttcgatgaatatagacaggacgtgacggcattcctcaag
gcgatggagccgatgaacctgcccaagccgtggttcctgatcggccattccatgggcggc
tgcatcgggttgcgcgcgctctatgatggtctggacgtggaggctgcgacctttaccggc
ccgatgtggggcctgcagatgagcaacctcctccgcacgctccagcccgcgatcaccaag
ctcgccgggccaatgggctttggcaagaccttcgcgcccaccaccggcccgtgggagccg
ctggaattcgaggacaattccctgaccactgaccgcgaccagtttgactacatgttccgc
cagaccgatgtgcatccggaactggccctgggcggcccttcgctcagctgggtcaaggcc
gcgctttgggaaacggaggatctgatggagaagacaccgctcgacctgcccgccctggcc
atcgtcggcaccggagagcagatcgtggacgtcgacgccgccaggacccgcatggccagc
tggcccaaaggcagctacctcagcatcgaaggcgggcgccatgaggtgttgatggaggcg
gatccactccgtgaccagtccctggacgccattctcgcactattccggaaagccgcgcgt
taa

DBGET integrated database retrieval system