KEGG   Jannaschia sp. CCS1: Jann_3314Help
Entry
Jann_3314         CDS       T00330                                 

Definition
alpha/beta hydrolase
Orthology
K01048  
lysophospholipase [EC:3.1.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:jan00564]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3368271..3369233
Genome map
AA seq 320 aa AA seqDB search
MLMTADITEPAPFYEAVAEGPANVAASWVRAADGTRLRMAVWPTPNQEGGSNGTVLMFPG
RTEYVEKYGRVASDLAENGYGMVAFDWRGQGLADRPPHRRDMGHVLTFDEYRQDVTAFLK
AMEPMNLPKPWFLIGHSMGGCIGLRALYDGLDVEAATFTGPMWGLQMSNLLRTLQPAITK
LAGPMGFGKTFAPTTGPWEPLEFEDNSLTTDRDQFDYMFRQTDVHPELALGGPSLSWVKA
ALWETEDLMEKTPLDLPALAIVGTGEQIVDVDAARTRMASWPKGSYLSIEGGRHEVLMEA
DPLRDQSLDAILALFRKAAR
NT seq 963 nt NT seq  +upstreamnt  +downstreamnt
atgttgatgaccgctgacatcaccgagcccgcaccgttctacgaggctgtcgccgagggg
ccggccaatgtcgcggcctcctgggtgcgggcggcagatggcacgcgcctgcgcatggcg
gtctggcccaccccaaatcaagaaggcgggtccaacggcaccgtactgatgtttccgggc
cgcacggaatatgtcgagaaatatggccgcgttgccagtgatctggcagaaaacggctac
ggcatggtggcgttcgactggcgcggtcagggtctggcggatcgcccgccgcatcgccgc
gacatgggccatgtgctcaccttcgatgaatatagacaggacgtgacggcattcctcaag
gcgatggagccgatgaacctgcccaagccgtggttcctgatcggccattccatgggcggc
tgcatcgggttgcgcgcgctctatgatggtctggacgtggaggctgcgacctttaccggc
ccgatgtggggcctgcagatgagcaacctcctccgcacgctccagcccgcgatcaccaag
ctcgccgggccaatgggctttggcaagaccttcgcgcccaccaccggcccgtgggagccg
ctggaattcgaggacaattccctgaccactgaccgcgaccagtttgactacatgttccgc
cagaccgatgtgcatccggaactggccctgggcggcccttcgctcagctgggtcaaggcc
gcgctttgggaaacggaggatctgatggagaagacaccgctcgacctgcccgccctggcc
atcgtcggcaccggagagcagatcgtggacgtcgacgccgccaggacccgcatggccagc
tggcccaaaggcagctacctcagcatcgaaggcgggcgccatgaggtgttgatggaggcg
gatccactccgtgaccagtccctggacgccattctcgcactattccggaaagccgcgcgt
taa

DBGET integrated database retrieval system