KEGG   Jannaschia sp. CCS1: Jann_3584Help
Entry
Jann_3584         CDS       T00330                                 

Definition
(GenBank) tryptophan synthase, alpha chain (EC:4.2.1.20)
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jann_3584
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jann_3584
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Jann_3584
Enzymes [BR:jan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Jann_3584
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3663309..3664100
Genome map
AA seq 263 aa AA seqDB search
MTRIDDTFARLSASGKKAFVSYIMAGDPDYATSLEVMRGLPAAGVDIIELGLPFTDPMAD
GSTIQLAGQRALDGGMTLDKTLQMVRDFRAGDDTTPIVLMGYYNPIYSRGVDRFLTDARE
AGIDGLIVVDLPPEEDEELCIPAQAAGLNFIRLATPTTDDARLPAVLSNTSGFLYYVSIT
GITGAAAPQAADVAPEVARIKSATDIPVIVGFGITTSEAARTIAGVADGCVVGSAIVSRI
AEGEPVADVLAFVKSLSDGAHAA
NT seq 792 nt NT seq  +upstreamnt  +downstreamnt
atgacccgtatcgacgacactttcgcgcgcctgtccgcatccggcaaaaaggccttcgtc
tcctacatcatggcgggcgatccggattacgcgacctcgcttgaggtcatgcggggtctg
cccgctgccggcgtcgacatcatcgaattggggctgccattcacggacccgatggccgac
ggctccaccatccagctggccgggcaacgcgccctcgacggtggcatgacactggacaag
acgttgcagatggtccgcgattttcgcgccggggacgacacgacgccgattgtgctgatg
ggctattacaacccgatctattcgcgcggcgtggaccggttcctgaccgacgcaagggaa
gcgggcattgacgggctgatcgtcgtcgacctgccgcccgaggaagatgaagagctgtgc
attcccgcccaggccgctggtctgaacttcatccggctggccacgccaaccaccgacgac
gcccgcctcccggccgtgctcagcaacacgtcggggtttctctactatgtctccatcacc
ggcatcactggggccgccgcgccccaggccgctgacgtggcccccgaagtcgctcgcatc
aaatccgccaccgacataccggtgatcgtgggcttcggcatcaccacatccgaggccgcc
cggaccatcgcaggtgtggccgatggctgcgtcgtcggatcagcgatcgtgtccaggatc
gcagagggcgagcccgtggccgatgttctggccttcgtcaaaagcctctcggacggggcg
cacgcggcctga

DBGET integrated database retrieval system