KEGG   Jannaschia sp. CCS1: Jann_3589Help
Entry
Jann_3589         CDS       T00330                                 

Definition
(GenBank) tryptophan synthase, beta chain (EC:4.2.1.20)
  KO
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Jann_3589
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Jann_3589
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Jann_3589
Enzymes [BR:jan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Jann_3589
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
3666152..3667381
Genome map
AA seq 409 aa AA seqDB search
MPDDLLNSFMTGPDEKGRFGDFGGRFVSETLMPLILELEQQYEHAKTDDSFWAEMQDLWT
HYVGRPSPLYFAKRLTERLGGAKIYLKRDELNHTGAHKINNVLGQIILARRMGKTRIIAE
TGAGQHGVATATVCAKFGLKCIVYMGATDVERQAPNVFRMKLLGAEVVPVTSGRGTLKDA
MNDALRDWVTNVRDTFYCIGTVAGPHPYPAMVRDFQAIIGKETRDQMMAAEGRLPDTLIA
AIGGGSNAMGLFFPFLDDKSVNIIGVEAGGHGVNEKMEHCASLTGGRPGVLHGNRTYLLQ
DEDGQILEGHSISAGLDYPGIGPEHAWLHEIGRAQYVSITDREALDAFQLSCETEGIIPA
LEPSHALAHVCKIAPDMPRDHLLVMNMCGRGDKDIFTVARALGWDMDGA
NT seq 1230 nt NT seq  +upstreamnt  +downstreamnt
atgccagacgatctattgaacagcttcatgacgggacccgatgaaaagggccggttcggt
gatttcggcgggcggtttgtgtcggagacgctgatgccgctgatccttgagctggagcag
caatatgagcacgcaaagaccgacgacagcttctgggccgagatgcaggacctctggacc
cattatgtgggtcgcccctctccgctctatttcgcgaaacgtctgaccgagcgtctgggc
ggcgcgaagatctacctcaaacgcgatgagctgaaccacacgggcgcccacaagatcaac
aacgtgttgggccagatcatcctggcgcggcgcatgggcaagacccgcattattgctgag
acaggagcgggccagcacggcgtggccaccgccacggtctgcgcgaagtttggcctcaaa
tgcatcgtctacatgggcgcgacggatgtggagcgtcaggcccccaacgtgttccgcatg
aagcttctgggcgcggaggtcgtaccggtgacctccgggcgcggcacactcaaggacgcg
atgaacgacgccctgcgcgactgggtcaccaacgtgcgcgataccttctactgcatcggc
acggtcgcaggtccccacccctaccccgccatggtccgcgattttcaggcgatcatcggc
aaggagacacgcgaccagatgatggccgcagaaggccgcctgcccgatacgctgatcgcc
gccatcggcggtggctccaacgccatgggcctgttcttcccattcctggacgacaagagt
gtgaacatcatcggggtggaggccggcggccacggcgtcaatgagaagatggaacattgt
gcatccctgaccgggggtcgccccggcgtgctgcacggcaatcggacgtatctgttgcag
gatgaggatggacagatccttgaagggcattcgatctcggccggtctggattatcccggg
atcggaccggagcacgcctggctgcacgagatcgggcgcgcgcaatatgtctccatcacg
gatcgggaagcgttggacgccttccagctgtcatgcgagactgagggtatcatcccggcg
ctggaaccgtcccacgcgctggcccacgtgtgcaagattgcgcccgatatgccccgcgat
catctgctggtgatgaacatgtgcggacgcggcgacaaggatatcttcaccgtcgcccgg
gccctcggctgggatatggacggggcctga

DBGET integrated database retrieval system