KEGG   Jannaschia sp. CCS1: Jann_3672Help
Entry
Jann_3672         CDS       T00330                                 

Definition
di-heme cytochrome c peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
jan  Jannaschia sp. CCS1
Brite
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     Jann_3672
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3748626..3750122
Genome map
AA seq 498 aa AA seqDB search
MMTDLSHSLRASASLRITTAAVLLMGTAAGGTDLPHPLADTDFLYDGAPSEALFALGRDL
FFDPILSGNRNISCGTCHDPAHGSGDGLALGFGTGGEGFGPDRHAGTGVTARVPRNAQPL
WNIGAREYVAMFHDGRLEPDPDGPFPSGYWSPAREELPEGLDSLLAAQAMFPVLSPVEMA
GWSGSNPVGTAVAQDRAPDAWDLIAERLQELPEYAAQFEAAFDDVTEPEHITFTHAARAL
AAFQTTAFRSTDSPFDTALQANDLSVLSPDAQRGAALFYGDAACAGCHSGPLLTDHGFHA
IAVPQIGPGKGHGADTTYFAASGFPDRLEDEGRFRVTFDPDDLFRFRTPSLRNVTLTGPW
GHSGAFDDLEQMVRHHLDAVASLETYEVQPDTLPAFETIITRRGAGSTLIFENLNPFRAG
AFAARDGFVQASDQLRTRIAAASAIEPIALSDREIADLMTFLATFTDPTAHNRSDLVPAT
VPSGLAPQPTPQPQGVAD
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atgatgaccgacctgtcacatagtttgcgcgcctcggcatcccttcggattaccactgcg
gccgtcctgctcatggggacggcggctggtggtacggacctgccacacccattggcggac
acggatttcctctacgatggcgcaccgtccgaggcgttgttcgccctggggcgcgacctg
ttctttgatccgatcctgtcgggcaaccgcaatatttcctgcgggacctgccatgatccg
gcccatgggtcaggtgacgggctcgccctcggctttggaaccggcggtgaggggtttggc
ccggaccgtcatgctggcacgggtgtgactgcgcgcgtgccacgcaatgctcaaccgctt
tggaacatcggggcgcgcgaatacgtcgccatgttccacgatggccgcctggaaccggac
cccgatggcccgttcccaagcgggtattggagcccggcgcgtgaggaattgccggaaggt
ctcgatagcctgcttgccgcgcaggcgatgttccccgtgctgtctcctgttgagatggcg
gggtggagtgggtcgaaccccgtgggcaccgccgttgcgcaggaccgggcgcccgacgcc
tgggatctgatcgcggagcggctgcaagaactgccagaatatgctgcgcaatttgaggcg
gccttcgatgatgtgaccgagcccgagcacattaccttcacccatgccgcccgcgccctt
gcggcattccagaccacggcatttcgatccaccgacagccccttcgatacggcattgcag
gccaacgatctgtccgttctgtcgcccgacgcgcagcgcggtgcggcgctcttctatggt
gacgcggcctgcgctggctgccattccggtccgcttctgaccgaccatgggttccacgcc
attgctgtgccgcaaatcgggcccggcaaaggtcacggggcggatacgacctattttgcc
gcctccgggttccccgaccggctggaagatgagggacggttccgcgtcaccttcgatccg
gacgacctgttccgctttcgcacgccatcgctgcgcaatgtcacgctgaccgggccttgg
ggtcacagcggtgcctttgacgatctggagcagatggtccgtcatcacttggatgccgtc
gcatcgcttgagacctacgaggttcagcccgacacgcttcccgcgttcgagacgatcatc
accaggcggggtgccggctcgaccctcatcttcgagaacctcaatccgttccgcgcaggt
gcctttgcggcccgtgatggttttgtgcaggcgagcgatcaactgcgcacccggatcgca
gcggccagcgccatcgaacccatcgcactcagtgatcgggagattgctgacctcatgaca
ttcctcgccacattcacagacccgaccgcccacaaccggagtgaccttgtcccggccacc
gtgccctcgggactggctccccaacctaccccacaaccgcaaggcgtggccgactag

DBGET integrated database retrieval system