KEGG   Jannaschia sp. CCS1: Jann_3685Help
Entry
Jann_3685         CDS       T00330                                 

Definition
G-D-S-L lipolytic protein
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
jan  Jannaschia sp. CCS1
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Jann_3685
Enzymes [BR:jan01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Jann_3685
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Jann_3685
Lipid biosynthesis proteins [BR:jan01004]
 Fatty acid synthase
  Component type
   Jann_3685
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3767540..3768226)
Genome map
AA seq 228 aa AA seqDB search
MKSRLNAKVSVGYGALRHWGKAVLFTLLATPVMAQEVTILALGDSLTAGYGLRQDAGLVP
QMQDWLDARGQDVTVINAGVSGDTTAGGLARLEWSLTPEVDAVIVALGGNDFLRGIDPGV
SRANLAGILDIAAREDLDVLLVGIVASGNYGPEYQQEFNAMYPDLAETYGTLLSRDFFDG
FRAPVEAGAGVAEFMQADGIHPNADGVALIVEDIGPLLEDLVERAATP
NT seq 687 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagccgtctcaacgcgaaggtgtccgttggatatggggccttgcggcactggggc
aaggcggttttgttcacgctgctggcaacgccggtgatggcgcaggaggtgacgatcctc
gcgctgggggacagtctgacggcgggctatgggttgcgccaggacgcgggccttgttccg
caaatgcaggactggctcgatgcgcgggggcaggatgtgacggtcatcaatgccggtgtc
tcaggggacacaacggcgggcggtttggcccgactggaatggagcctgacgccggaggtc
gacgccgtcatcgtggcgcttggaggtaacgattttctgcgcggcatcgacccgggcgtg
agccgcgcgaaccttgcagggatcctagacatcgcggcgcgagaggatctggacgtgctt
ttggtgggtatcgtggcctccggcaattatgggccggagtaccagcaagagttcaacgcc
atgtacccggacttggcggagacctacggcaccctgctgtcacgcgatttcttcgacggc
tttcgcgccccggtggaggccggggcaggggttgcggagttcatgcaagcggacggaatt
caccccaacgcggatggggttgcgttgatcgtggaggatatcgggccgctgttggaggat
ctggtcgagcgcgccgccacgccctga

DBGET integrated database retrieval system