KEGG   Jannaschia sp. CCS1: Jann_3703Help
Entry
Jann_3703         CDS       T00330                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00010  Glycolysis / Gluconeogenesis
jan00620  Pyruvate metabolism
jan00640  Propanoate metabolism
jan00680  Methane metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_3703
   00620 Pyruvate metabolism
    Jann_3703
   00640 Propanoate metabolism
    Jann_3703
  Energy metabolism
   00680 Methane metabolism
    Jann_3703
Enzymes [BR:jan01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     Jann_3703
Lipid biosynthesis proteins [BR:jan01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   Jann_3703
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: ABD56620
JGI: Jann3703
UniProt: Q28KZ2
Position
3786505..3788442
Genome map
AA seq 645 aa AA seqDB search
MPKDQLPPLLPDAHIDAARYDEMYAASVADPEAFWDEHGKRIDWIKPYTKVKDTSFAHDD
VHIRWFEDGTLNVSANCIDRHLAERGDQTAILFEPDEPTDPAQHITYNQLHVEVSKFANV
LKGLGVGRGDRVVLYMPMIPEAAYAMLACTRIGAVHSIVFAGFSPDALSARINGCDAKLV
ITSDGAPRGGRVTELKDNVNKALLHNQIKTQCLVVKRTGGQVAWIADRDHWYHELAETVS
ADCPPEEMGAEDPLFILYTSGSTGMPKGVVHTTGGYIVYASMTHEYTFDYKDGDVFWCTA
DVGWVTGHSYIVYGPLANGGTTLMFEGVPTYPDAGRFWEVCEKHKVNQFYTAPTAIRALM
GKGTSFVEKYDLSSLKLLGTVGENINPEAWNWYNENVGKGRCPIVDTWWQTETGGHMMTP
LPGAHTLKPGSAQKPFFGVQPLVLDPTSAEVIEGNDVEGVLVIADSWPGQMRTVWGDHER
FVATYFSDYKGYYFSGDGCKRDADGEYWITGRVDDVINVSGHRMGTPEIESALVAHETVS
EAAVVGYPHPVKGQGIYCYVTLMNDETPSDELKATLQAWVRQEIGPIAKPDVIQWAPGLP
KTRSGKIMRRILRKIAENDYGALGDTSTLADPSVVDDLIANRADT
NT seq 1938 nt NT seq  +upstreamnt  +downstreamnt
gtgcccaaagatcaactgccgcccctgttgcctgacgcccatatcgacgctgcccgctat
gacgagatgtacgcggcctccgttgcggacccggaggctttctgggacgagcatggcaag
cgcatcgactggatcaagccctatacaaaggtgaaagacacgtctttcgcccatgacgat
gtgcatatccgctggtttgaagacggcaccctgaacgtcagcgccaactgcatcgaccgt
catctggcggagcgtggcgaccagaccgcgatcctgtttgagcccgatgagccgacagat
cccgcacagcatatcacctacaaccagcttcatgtcgaagtcagcaaattcgccaacgtc
ctgaagggcctgggcgtggggcgcggcgaccgtgtggtcctttacatgccgatgatcccg
gaggcggcctacgcgatgctggcctgcacgcgcatcggggcggtgcattccatcgtcttc
gcgggcttctctcccgatgcgctgtccgcccggatcaatggctgtgacgccaagctggtg
atcacctctgacggggccccgcgcgggggtcgggtgacggagctgaaagacaacgtcaac
aaggcgctcttgcacaaccagatcaagacccagtgcctcgttgtgaagcgcaccggcggg
caggttgcctggatcgcggaccgggaccattggtatcacgagctggccgaaaccgtttca
gccgattgcccgcccgaagagatgggggccgaagacccgctgttcattctttacacgtcc
ggctccaccggcatgcccaagggcgtggtgcatacgacgggcggctacatcgtctatgcc
tccatgacccacgaatacacgtttgactacaaggacggcgacgtcttctggtgcacggcg
gatgtgggctgggtcacgggccacagctatatcgtctatggcccgctggccaatggcggc
accacgctgatgtttgagggcgtgcccacctaccccgacgcgggccggttctgggaagtc
tgcgagaaacacaaggtcaaccagttctacaccgcccccaccgccatccgcgcgttgatg
ggtaaggggacgtcctttgtggagaagtacgacctgagcagtctgaaattgctgggaacg
gtcggcgaaaacatcaaccctgaggcctggaactggtacaacgagaatgtcggtaagggc
cgctgccccatcgtcgacacgtggtggcagacggaaacgggcggccacatgatgaccccc
ctgcccggcgcgcatacgttgaagcccggatcggcgcagaagccgttctttggcgtgcaa
ccgctggtgctggacccgacgagcgcggaggttattgagggcaatgacgtggaaggcgtg
ctggtcatcgccgacagctggcccggccagatgcgcaccgtctggggcgaccatgagcgg
ttcgtggccacctatttcagcgactacaagggctactacttcagcggcgacggctgcaaa
cgcgacgcggacggtgagtattggatcacgggccgcgtggacgatgtgatcaacgtatcg
ggccaccgcatgggcacgcccgagatcgagagcgcgctggtcgcccatgaaaccgtgtcc
gaggccgccgtggtcggctacccgcatccggtcaaaggccagggcatctattgctacgtg
accctgatgaatgatgagacgccgtccgatgaattgaaggccacgttgcaggcctgggtc
cggcaagagattggcccaatcgccaagccggacgtcatccaatgggcgccgggcctgccc
aagacccgctccggcaagatcatgcggcgcatcctgcgcaagatcgccgagaatgattac
ggcgcgcttggcgatacgtccacattggccgatccatcggtggtggacgatctgatcgcc
aaccgcgcggacacctga

DBGET integrated database retrieval system