KEGG   Jannaschia sp. CCS1: Jann_3878Help
Entry
Jann_3878         CDS       T00330                                 

Gene name
recR
Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
jan  Jannaschia sp. CCS1
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:jan00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Jann_3878 (recR)
DNA repair and recombination proteins [BR:jan03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Jann_3878 (recR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3977057..3977656
Genome map
AA seq 199 aa AA seqDB search
MADTSKDIEELIGIMARLPGLGPRSARRAVLTLIKKRGALMRPLAETMARVAESARECVN
CGNIGTGDLCEICMDVRRATGEICVVEDVADLWAMERGQAFKGRYHVLGGTLSALDDVGP
EDLRIPKLRARMADEGITEVILALNATVDGQTTAHYIADELAPTGVTLSSLAQGVPIGGE
LDYLDDGTISAALRARKSL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttggcggacacctccaaagacatcgaagagctgatcgggattatggcacgcctgccgggt
cttgggccacggtcggctcggcgtgcggtgctgacgctgatcaagaagcgtggcgctttg
atgcgtcccttggccgagaccatggcgcgcgtcgccgagagcgcgcgggaatgtgtgaac
tgcggcaatatcggcacgggagatctctgcgagatctgcatggatgtccgccgcgcgact
ggagagatctgcgtcgtggaggacgtcgcagatctgtgggcgatggaacgagggcaggcg
ttcaagggccgctaccacgtcctggggggaacattatcggctttggatgatgtgggtccc
gaggacctgcgcatccccaaactgcgtgcgcgcatggccgatgaagggatcaccgaggtc
atcctggcgctgaacgcgacggtcgatggccaaacgacggcgcattacatcgccgatgag
ctggcaccgacgggcgtaaccctgtcgtcgctggcacagggcgtgcccatcggcggagag
ttggactaccttgacgatggcaccatttccgcagcgttgcgcgcgcgcaaaagcctgtga

DBGET integrated database retrieval system