KEGG   Jannaschia sp. CCS1: Jann_3964Help
Entry
Jann_3964         CDS       T00330                                 

Definition
zinc-binding alcohol dehydrogenase
Orthology
K00001  
alcohol dehydrogenase [EC:1.1.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Jann_3964
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_3964
  Lipid metabolism
   00071 Fatty acid degradation
    Jann_3964
  Amino acid metabolism
   00350 Tyrosine metabolism
    Jann_3964
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Jann_3964
   00626 Naphthalene degradation
    Jann_3964
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Jann_3964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4062259..4063293
Genome map
AA seq 344 aa AA seqDB search
MRAAVVRDFNADLALERVPDPACPETGVVLEVAACGVCRSDYHGWTGGHPNVVNGSILGH
EYCGTVVEAGPRAQHKVGDRLIAPFILGCGACPACQTGASNTCAHQVVPGFGAPGAYAEC
VAVPFDHNLVHLPDSLSPALAAGLGCRVTTAWQALTDRADVKAGEWVAVHGTGGIGLSVL
LLAKMLGARVVVVDIVDEKLEHAVTHGADATVNASQVDAAAAIRDITGGGAHVSIEALGI
AATTNASVECLATLGRHVHVGMPAGDGMMEINMRAIYAKQLAFYGTRGMPSWKYPTLLGM
IERGDVDISPMVAREIPLSAASAELRAMGGPTPPGTAVITDFLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcggttgtccgggacttcaacgcggatctggcgctggagcgcgtgcctgac
cccgcctgccccgagactggcgtggtgctggaggttgcggcctgtggcgtgtgccggtcc
gattaccacggctggacgggcgggcacccgaacgtcgtgaatggctccatcctcggccat
gaatattgcggcacggtggtggaggccgggccgcgtgcgcaacacaaggtaggtgatcga
ctgatcgcgccctttatccttggctgcggagcctgccccgcttgccaaacgggtgcgtcc
aacacctgcgcccatcaggtcgtgccgggcttcggcgcgccaggtgcctatgccgaatgc
gtcgccgtgccgtttgatcacaatcttgtccatctgcccgatagcctgtcacccgccctt
gccgccgggcttggctgccgggtcacaaccgcctggcaagcgctgacggaccgggcggat
gtgaaggccggcgaatgggtcgccgtccatggcacgggcggcatcggtctgtcggtgctg
ctgctggcgaagatgcttggcgcgcgggttgtggtggtcgatatcgttgacgagaagctg
gagcacgccgtgacccacggggctgacgcgacggtcaacgcgtcacaggttgatgcggcg
gcggcgatccgggacatcaccggcggtggcgcacacgtctcgatcgaggctctggggatt
gcggccaccacgaatgcgtcggtggagtgtctggccacgctgggtcggcacgtccatgtg
gggatgcccgcaggtgatggcatgatggagatcaacatgcgcgcgatctacgccaagcag
cttgctttctatggcacgcgcgggatgccgtcttggaaatatccaacgcttctgggcatg
attgaacgcggcgatgtggatatttcccccatggtcgcccgcgaaatccccctgtcagcc
gcaagcgccgagttgcgcgcgatgggtggcccgacaccgcccggcacggcggtgatcacg
gattttctggggtag

DBGET integrated database retrieval system