KEGG   Jannaschia sp. CCS1: Jann_3964Help
Entry
Jann_3964         CDS       T00330                                 

Definition
(GenBank) Alcohol dehydrogenase zinc-binding protein
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00010  Glycolysis / Gluconeogenesis
jan00071  Fatty acid degradation
jan00350  Tyrosine metabolism
jan00625  Chloroalkane and chloroalkene degradation
jan00626  Naphthalene degradation
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
jan01130  Biosynthesis of antibiotics
jan01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jann_3964
  Lipid metabolism
   00071 Fatty acid degradation
    Jann_3964
  Amino acid metabolism
   00350 Tyrosine metabolism
    Jann_3964
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Jann_3964
   00626 Naphthalene degradation
    Jann_3964
Enzymes [BR:jan01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Jann_3964
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_zinc_N ADH_N 2-Hacid_dh_C ADH_zinc_N_2 Urocanase Methyltransf_25 AIRS_C 3HCDH_N AlaDh_PNT_C
Motif
Other DBs
NCBI-ProteinID: ABD56881
JGI: Jann3964
UniProt: Q28K81
Position
4062259..4063293
Genome map
AA seq 344 aa AA seqDB search
MRAAVVRDFNADLALERVPDPACPETGVVLEVAACGVCRSDYHGWTGGHPNVVNGSILGH
EYCGTVVEAGPRAQHKVGDRLIAPFILGCGACPACQTGASNTCAHQVVPGFGAPGAYAEC
VAVPFDHNLVHLPDSLSPALAAGLGCRVTTAWQALTDRADVKAGEWVAVHGTGGIGLSVL
LLAKMLGARVVVVDIVDEKLEHAVTHGADATVNASQVDAAAAIRDITGGGAHVSIEALGI
AATTNASVECLATLGRHVHVGMPAGDGMMEINMRAIYAKQLAFYGTRGMPSWKYPTLLGM
IERGDVDISPMVAREIPLSAASAELRAMGGPTPPGTAVITDFLG
NT seq 1035 nt NT seq  +upstreamnt  +downstreamnt
atgcgcgcagcggttgtccgggacttcaacgcggatctggcgctggagcgcgtgcctgac
cccgcctgccccgagactggcgtggtgctggaggttgcggcctgtggcgtgtgccggtcc
gattaccacggctggacgggcgggcacccgaacgtcgtgaatggctccatcctcggccat
gaatattgcggcacggtggtggaggccgggccgcgtgcgcaacacaaggtaggtgatcga
ctgatcgcgccctttatccttggctgcggagcctgccccgcttgccaaacgggtgcgtcc
aacacctgcgcccatcaggtcgtgccgggcttcggcgcgccaggtgcctatgccgaatgc
gtcgccgtgccgtttgatcacaatcttgtccatctgcccgatagcctgtcacccgccctt
gccgccgggcttggctgccgggtcacaaccgcctggcaagcgctgacggaccgggcggat
gtgaaggccggcgaatgggtcgccgtccatggcacgggcggcatcggtctgtcggtgctg
ctgctggcgaagatgcttggcgcgcgggttgtggtggtcgatatcgttgacgagaagctg
gagcacgccgtgacccacggggctgacgcgacggtcaacgcgtcacaggttgatgcggcg
gcggcgatccgggacatcaccggcggtggcgcacacgtctcgatcgaggctctggggatt
gcggccaccacgaatgcgtcggtggagtgtctggccacgctgggtcggcacgtccatgtg
gggatgcccgcaggtgatggcatgatggagatcaacatgcgcgcgatctacgccaagcag
cttgctttctatggcacgcgcgggatgccgtcttggaaatatccaacgcttctgggcatg
attgaacgcggcgatgtggatatttcccccatggtcgcccgcgaaatccccctgtcagcc
gcaagcgccgagttgcgcgcgatgggtggcccgacaccgcccggcacggcggtgatcacg
gattttctggggtag

DBGET integrated database retrieval system