KEGG   Jannaschia sp. CCS1: Jann_4081Help
Entry
Jann_4081         CDS       T00330                                 

Definition
(GenBank) uroporphyrinogen-III synthase putative
  KO
K01719  uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
jan  Jannaschia sp. CCS1
Pathway
jan00860  Porphyrin and chlorophyll metabolism
jan01100  Metabolic pathways
jan01110  Biosynthesis of secondary metabolites
jan01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jan00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Jann_4081
Enzymes [BR:jan01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Jann_4081
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HEM4
Motif
Other DBs
NCBI-ProteinID: ABD56998
JGI: Jann4081
UniProt: Q28JW4
Position
4186615..4187205
Genome map
AA seq 196 aa AA seqDB search
MEIVGTGAEIDLAGVHGLILTSQAAVPFVPQTTLPAYCVGARTTAVARGAGISADFVGED
ADALVQALAARRPDGPLLHLHGTHTRGDIARRLSAHGITVQSLTLYDQRDCPPDPAFYDA
ITRPDLIVPLFSPRSAILFAAASQTLRDDTVLLALSPAVAHALPPRMQTQTRVAAAPTGQ
QMRDLLEPLGVQRNSP
NT seq 591 nt NT seq  +upstreamnt  +downstreamnt
atggagattgtcggcaccggggccgagatcgaccttgcgggcgtgcatggcctgatcctg
acgtcccaggcggcggtccccttcgtgccgcaaaccaccctgccggcctattgcgtcgga
gcgcgaaccaccgctgtggcgcgcggggcggggatatcggcagactttgtgggtgaggat
gccgacgctttggtgcaagcattggccgcgcgcaggccagacgggccgttgctgcatctg
catggcacccatacgcgcggggatattgcgcggcggctgtctgcccatggtatcaccgtc
caaagcctcacattatatgatcagcgggattgcccgccggatcccgcgttttacgatgcg
ataacccggcccgacctgatcgtgccgctattctcgccacgcagtgccatcttgttcgcg
gccgccagccaaaccctgcgcgacgacacggtcctgcttgcgctcagccccgccgtggcc
cacgcgctgccgccccggatgcagacccaaacccgggtcgctgccgcgcccacgggccaa
caaatgcgcgacctgctggaaccattgggcgtgcaaaggaattccccctag

DBGET integrated database retrieval system