KEGG   Jannaschia sp. CCS1: Jann_4210Help
Entry
Jann_4210         CDS       T00330                                 

Definition
(GenBank) DNA-(apurinic or apyrimidinic site) lyase (EC:4.2.99.18)
  KO
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
jan  Jannaschia sp. CCS1
Pathway
Base excision repair
Brite
KEGG Orthology (KO) [BR:jan00001]
 Genetic Information Processing
  Replication and repair
   03410 Base excision repair
    Jann_4210
Enzymes [BR:jan01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.23  DNA-formamidopyrimidine glycosylase
     Jann_4210
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.99  Other carbon-oxygen lyases
    4.2.99.18  DNA-(apurinic or apyrimidinic site) lyase
     Jann_4210
DNA repair and recombination proteins [BR:jan03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Jann_4210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
4315345..4316196
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLAPVLEGARIAQAAVNRPDLRWPFPDNMAQRLTGATVTALRRRSKYI
LADLDTGETLLIHLGMSGRMQISGDVIGSFHHTHPAAAKHDHVVLDTDAGARITFNDARR
FGAMDLMDTATQDQHWLLRDLGPEPLGNAFNEAHLVAAFKGKRSPVKTALLDQRIVSGLG
NIYVCEALWRAGISPLRQAGKIAAVRVATLVPIIRDVLTEAIEAGGSSLRDHRQATGELG
YFQHTFRVYGREGQRCQTPDCAEKILRKVQSGRSSFYCPACQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaacttccagaggtagagacagtgcgtcgcggcctggccccggtgttggaaggg
gcgcggatcgcccaagcggcggtgaaccgccccgatctgcgctggccgtttccggacaac
atggcgcagcggctgactggggcgacggtcactgccctgcggcgtcggtcaaaatacatc
cttgccgatcttgataccggggagacgttgctgatccatctggggatgtccgggcgcatg
cagatctcgggcgatgtcatcggcagttttcaccacactcatccggcagcagcgaagcac
gaccacgttgttcttgataccgacgccggcgcgcggatcaccttcaacgacgcacgccgg
ttcggcgcgatggacctgatggacaccgccacgcaggatcagcactggctgctccgcgac
ctggggccggaacctttgggcaatgcgtttaatgaagcgcatctggttgctgcgttcaaa
ggcaagcggtcaccggtcaaaacagcgctgctcgatcaacgcatcgtctcgggccttggc
aacatatatgtgtgtgaggcgctatggcgggccgggatcagtcccctgagacaagcggga
aagatcgcggcggtccgagtcgccacccttgttccgatcatccgcgatgtcctaacggaa
gctatcgaagccggtggctcttccttacgagatcatcggcaagcaaccggggaactggga
tattttcaacacacctttagggtgtatgggcgggaaggccaacggtgccaaaccccagat
tgcgctgaaaaaatcctgcgcaaggtgcagtcgggacgctccagtttctactgtccggcc
tgtcagagataa

DBGET integrated database retrieval system