KEGG   Jannaschia sp. CCS1: Jann_4210Help
Entry
Jann_4210         CDS       T00330                                 

Definition
formamidopyrimidine-DNA glycosylase
Orthology
K10563  
formamidopyrimidine-DNA glycosylase [EC:3.2.2.23 4.2.99.18]
Organism
jan  Jannaschia sp. CCS1
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:jan03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
4315345..4316196
Genome map
AA seq 283 aa AA seqDB search
MPELPEVETVRRGLAPVLEGARIAQAAVNRPDLRWPFPDNMAQRLTGATVTALRRRSKYI
LADLDTGETLLIHLGMSGRMQISGDVIGSFHHTHPAAAKHDHVVLDTDAGARITFNDARR
FGAMDLMDTATQDQHWLLRDLGPEPLGNAFNEAHLVAAFKGKRSPVKTALLDQRIVSGLG
NIYVCEALWRAGISPLRQAGKIAAVRVATLVPIIRDVLTEAIEAGGSSLRDHRQATGELG
YFQHTFRVYGREGQRCQTPDCAEKILRKVQSGRSSFYCPACQR
NT seq 852 nt NT seq  +upstreamnt  +downstreamnt
ttgcccgaacttccagaggtagagacagtgcgtcgcggcctggccccggtgttggaaggg
gcgcggatcgcccaagcggcggtgaaccgccccgatctgcgctggccgtttccggacaac
atggcgcagcggctgactggggcgacggtcactgccctgcggcgtcggtcaaaatacatc
cttgccgatcttgataccggggagacgttgctgatccatctggggatgtccgggcgcatg
cagatctcgggcgatgtcatcggcagttttcaccacactcatccggcagcagcgaagcac
gaccacgttgttcttgataccgacgccggcgcgcggatcaccttcaacgacgcacgccgg
ttcggcgcgatggacctgatggacaccgccacgcaggatcagcactggctgctccgcgac
ctggggccggaacctttgggcaatgcgtttaatgaagcgcatctggttgctgcgttcaaa
ggcaagcggtcaccggtcaaaacagcgctgctcgatcaacgcatcgtctcgggccttggc
aacatatatgtgtgtgaggcgctatggcgggccgggatcagtcccctgagacaagcggga
aagatcgcggcggtccgagtcgccacccttgttccgatcatccgcgatgtcctaacggaa
gctatcgaagccggtggctcttccttacgagatcatcggcaagcaaccggggaactggga
tattttcaacacacctttagggtgtatgggcgggaaggccaacggtgccaaaccccagat
tgcgctgaaaaaatcctgcgcaaggtgcagtcgggacgctccagtttctactgtccggcc
tgtcagagataa

DBGET integrated database retrieval system