KEGG   Jatropha curcas: 105631448Help
Entry
105631448         CDS       T03922                                 

Definition
(RefSeq) beta-fructofuranosidase, insoluble isoenzyme CWINV1
  KO
K01193  
beta-fructofuranosidase [EC:3.2.1.26]
Organism
jcu  Jatropha curcas
Pathway
Galactose metabolism
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jcu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    105631448
   00500 Starch and sucrose metabolism
    105631448
Enzymes [BR:jcu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     105631448
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GeneID: 
NCBI-ProteinID: 
UniProt: 
Position
Unknown
AA seq 579 aa AA seqDB search
MATSFSSLTLRLFFFFAVLLGHGVFELEASHHIYDQTLQSLESTDSTSITQPYRTGYHFQ
PPKNWMNDPNGPMIYKGIYHLFYQYNPKEAVWGNIVWAHSTSRDLVNWTPHKFAIYPSQP
GDINGTWSGSATFLPNGTPAILYTGINPQNQQVQNLAMPKNTSDPYLLDWVKTPRNPLMA
PNAQNQINATSFRDPTTAWLGADGRWKVIIGSKIHRRGLAILYTSKDFINWVKAKHPLHS
AEGTGMWECPDFFPVLANGKNGVDLKIQKGVKYVLKFSLDDTKHDHYTIGDYDHVKDIYT
PNRGSTDGDSGLRYDYGKFYASKTFFDSAKNRRILWGWSNESSSVSDDIKKGWAGIQAIP
RVIWLGKSGKQLIQWPIEEIEKLRTNPINLPRKVLKKGSVLQVAGVTAAQADVEISFKVS
NLEKAEVLNPSWTNPQLVCSRKGASVRGSLGPFGLLVLASNGFEEYTSVFFRIFKRQNKY
VVLMCSDQSRSSLNPGNDKTTYGAFVDVDPVHEQISLRSLIDHSVVESFGGGGKSCILTR
VYPQLAINEAAHLHAFNNGSESVTITRFSAWSMKKARIN
NT seq 1740 nt NT seq  +upstreamnt  +downstreamnt
atggccacctctttctcttctcttactcttaggctcttcttcttcttcgctgtccttctt
ggccacggagtttttgagcttgaagcttctcatcacatttatgatcagactcttcaaagt
cttgaatccacagattctacttccataactcaaccttacagaactggttaccattttcaa
cctcccaagaactggatgaacgatcctaatgggccaatgatttataagggaatttaccat
cttttctaccaatacaatcctaaagaagctgtgtggggcaacatagtatgggcccactca
acatcgagggatcttgttaattggaccccacataaatttgcaatctacccatcacagcca
ggtgatatcaacggtacctggtctggttcagctacatttctccctaatggtacacctgct
atcctttacactggaataaacccacaaaaccagcaagttcaaaacttggccatgcccaaa
aacacatctgacccataccttctagattgggtcaaaacccctagaaatccattaatggca
cccaatgcccaaaaccaaattaatgctacttcatttagagacccaactactgcttggtta
ggtgctgatggtagatggaaagtgattattggtagcaaaatccatagaagaggattagca
attctttatacaagtaaagatttcattaactgggttaaagctaaacacccattgcattct
gctgagggcactggaatgtgggagtgtcctgatttttttcctgtgttagcaaatggtaaa
aacggagttgatttgaaaattcagaaaggtgttaagtatgtgcttaagtttagtttagat
gatacaaaacatgatcattacactattggagattatgatcatgtgaaggatatttatact
cctaatagaggatcaactgatggtgattctgggttacgatatgattatggtaaattttat
gcttcaaaaactttctttgatagtgctaagaatagaaggattctgtggggttggtctaat
gagtcttcaagtgttagtgatgatatcaagaagggttgggctggaattcaggcaattcca
agagttatttggcttggcaaatcaggaaagcaattgatccaatggcctattgaggaaatt
gaaaagttacgtacaaatccaatcaacttgcctagaaaagtccttaagaaagggtctgtg
cttcaagttgcaggtgtcacagcagctcaggcagatgtggagatttcatttaaggtatca
aatttggagaaagcagaagtgctaaacccaagctggaccaatccacaattggtttgcagc
cgaaagggtgcatcagttagaggtagtttaggtccatttgggttgctagttttggcttca
aatggatttgaagagtacacatcagtattctttagaatattcaaaagacaaaacaaatat
gtggtgcttatgtgcagcgaccaaagcaggtcttcactaaacccaggtaatgataagacc
acttatggagcttttgtggatgtggatcctgttcatgagcagatttcattaaggagcttg
attgatcattctgtggtggagagctttggtggaggtggaaagagctgcattttaaccaga
gtttatccccagttggctataaatgaggctgcccacttgcatgcttttaataatggcagt
gaaagtgttactattacaagatttagtgcttggagcatgaagaaagctcgtatcaactga

DBGET integrated database retrieval system