KEGG   Jeotgalibaca dankookensis: BW727_101415Help
Entry
BW727_101415      CDS       T04733                                 

Gene name
thlA
Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  
acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
jda  Jeotgalibaca dankookensis
Pathway
Fatty acid degradation
Synthesis and degradation of ketone bodies
Valine, leucine and isoleucine degradation
Lysine degradation
Benzoate degradation
Tryptophan metabolism
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Propanoate metabolism
Butanoate metabolism
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Fatty acid metabolism
Two-component system
Brite
KEGG Orthology (KO) [BR:jda00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    BW727_101415 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    BW727_101415 (thlA)
   00640 Propanoate metabolism
    BW727_101415 (thlA)
   00650 Butanoate metabolism
    BW727_101415 (thlA)
  Lipid metabolism
   00071 Fatty acid degradation
    BW727_101415 (thlA)
   00072 Synthesis and degradation of ketone bodies
    BW727_101415 (thlA)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    BW727_101415 (thlA)
   00310 Lysine degradation
    BW727_101415 (thlA)
   00380 Tryptophan metabolism
    BW727_101415 (thlA)
  Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    BW727_101415 (thlA)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    BW727_101415 (thlA)
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    BW727_101415 (thlA)
Enzymes [BR:jda01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     BW727_101415 (thlA)
Exosome [BR:jda04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   BW727_101415 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
UniProt: 
Position
complement(1439903..1441087)
Genome map
AA seq 394 aa AA seqDB search
MMREVVIVQALRTPMGAFGGALKNVSAVDLGAHAVKEAMASINLDPSLVDELIFGNVLSA
GLGQNVARQVAVNSGIPKHVPSFTINKVCGSGLKTVALAAQSIIAGDNEIVIAGGTEVMS
QAPYVVNDARWGARMGDTKMVDTMLKDGLMDAFNDIHMGMTAENIVEKYGFTRQQQDELA
VLSQNNAEKAIKSGRFKDEIIPFPVPQRRGEPVVFDTDEYPRFGTTMESMSKLKPAFKRD
GGTVTAGNSSGLNDGAAVVIVMSKEKAEELGFEPMATIKSYASAGVEPKIMGCGPIPATK
KALKKANLEVSDLELIEANEAFAAQALSVITDLGLDTSITNVNGGAIALGHPIGASGARI
LVTLLHEMKKRDSKRGLATLCIGGGQGIALVVER
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgatgcgtgaagtagttattgtacaagcactaagaacaccaatgggagcttttggagga
gcattgaaaaatgtttcagctgttgatttaggagcgcatgctgttaaagaagcaatggca
agtattaatctagatcctagcctagtcgatgaattaatttttggtaatgtattgagcgca
gggctcggacaaaacgtagcacgtcaagtagctgttaactcagggattccaaaacacgtt
ccatcatttacaattaataaagtgtgtggttcagggttaaaaacagtggcattagcagca
caatctattattgcaggggacaacgaaattgtgatcgccggtggaaccgaagtgatgagt
caagcgccttacgttgtgaacgatgcgcgttggggtgcacgtatgggtgatacaaaaatg
gttgataccatgcttaaagatgggttgatggatgcttttaatgacattcatatgggtatg
acagcagaaaacatcgttgaaaaatacggttttaccagacaacaacaagatgaattagct
gtattgagtcaaaataatgctgaaaaagcaattaaatcaggccgttttaaagatgaaatt
attccgttcccagtcccacaaagaagaggcgaacctgttgtttttgatacagacgaatat
cctcgctttggaacaactatggaatctatgagtaaacttaaacctgctttcaaacgtgat
ggcggaaccgttacagctggaaattcatccggattaaatgatggcgcagcagtagtcatt
gttatgtcaaaagaaaaagctgaagagctaggatttgaaccgatggcaacaatcaagtct
tatgcaagtgcgggagtagaaccgaaaattatgggttgtggaccaattccagcaaccaaa
aaagcattgaaaaaagcaaatctagaagtatctgatttagaattaattgaagcaaacgaa
gcatttgcggcgcaagcgttaagtgttattacagaccttggcttagacacaagtattact
aacgttaatggtggtgcgatagccctcggacacccaattggtgcaagtggcgctcgtatc
cttgtaacactcttacatgaaatgaaaaaacgtgattcgaaacgcggtttagctacccta
tgtattggtggcggacaaggaattgctttagttgtagaaagataa

DBGET integrated database retrieval system