KEGG   Jonesia denitrificans: Jden_0104Help
Entry
Jden_0104         CDS       T00972                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
jde  Jonesia denitrificans
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Jden_0104
Enzymes [BR:jde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     Jden_0104
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
115545..117299
Genome map
AA seq 584 aa AA seqDB search
MSVFAIGERDFTLDGEPFQIISGAIHYFRVHPDSWRDRIRKARLMGLNTIETYVAWNFHA
PSRDEFHTDGARDLGRFLDIIQEEGLRAIVRPGPYICAEWDNGGLPTWLTATPDIVVRSS
DPTYLTEVERYLEHLAPIVEPRQINHGGPIILMQVENEYGAYGNDRAYLTHLTNVYRNLG
FVVPLTTVDQPMDDMLAHGTLPDLHTTGSFGSRIDERLATLREHQTTGPLMCSEFWIGWF
DHWGAHHHTTDVADAANALDRLLGAGASVNIYMFHGGTNFGFTNGANDKGVYQPLVTSYD
YDAPLAEDGYPTEKYWAFREVIARYAPVPAEVPAERPLVAERSVPLTHRVGWLDVPLDVD
EAVTCDSPATFDGLNVSGPFVVYERDIAVEGDAVLRFNQVRDIAYVFVDTTFVGVAYRDH
HDAFIPLPTDARGTLRVLVEDQGRVNYGPRLGEWKGMGTVELQGHILTGWRVTPCDPLLA
ERAAWHEISTLSDAIPGPVMLRGDVHVDVPENLYLDTSGWGKGAVWVNGFNVGRYWSRGP
QHTLFVPAELLRPGVNSIMVFELFGVASAHVVCAAGPDLGHTEF
NT seq 1755 nt NT seq  +upstreamnt  +downstreamnt
atgtcagtttttgcgatcggtgagcgtgacttcaccctcgacggagaaccattccagatc
atttctggggcgatccactattttcgggtccaccctgactcgtggcgggaccggatccgc
aaagcacgcctcatggggctcaacacgattgaaacctacgttgcctggaacttccatgca
cccagtcgggacgagttccatacagatggggcgcgcgaccttggtcgcttcttggacatc
atccaggaggagggcttgcgggctattgttcgacctggcccctatatttgcgctgaatgg
gataacggcggcttgcccacgtggctcaccgccaccccagatatcgtcgtgcgcagttca
gacccgacctaccttacagaggtagaacggtatcttgagcaccttgcccccattgtggag
ccccgccagatcaaccatggaggccctatcatcctcatgcaggtggaaaacgagtacggc
gcatacggcaatgaccgcgcctacctgacacacctgacgaacgtgtaccggaacctcggc
tttgtggtgccactgaccacagtggaccaacctatggatgacatgcttgcgcacgggacg
ctgccagacctccacacaactggctcatttggttcgcgcatcgacgaacggttggctacc
ctacgagaacaccaaaccacagggccgctcatgtgctcggagttttggattggctggttt
gaccactggggcgcccaccaccacactactgatgttgctgatgcggcaaacgcgctggac
cgcctgctaggtgcaggcgcatcggtcaatatttacatgttccatggcggcacaaacttt
gggttcaccaacggggcgaatgataaaggcgtctatcagccgttggtgaccagctacgac
tatgacgccccccttgccgaagatggttacccgaccgagaagtactgggcttttcgcgag
gtcatcgcgcggtatgcacctgttcccgctgaggtgcctgcggagcgtcccttggttgcg
gaacggtccgtgccgttgacgcatcgggtgggctggttggacgttccgttggatgtggat
gaggcagtcacgtgtgacagtccggccacgtttgatggcctcaacgtgtcgggtccgttt
gtggtgtatgagcgcgacatcgctgttgagggtgacgcggtcctgcggtttaaccaggtg
cgggacatcgcctacgtgtttgtggacacaacctttgtgggggtagcgtaccgcgaccac
catgatgcttttattcccttgcctaccgatgcgcgtggaacgttacgtgtgttggtggag
gatcagggacgggtcaactatgggccacgtttgggcgaatggaaagggatggggactgtt
gaactgcaaggccacattctcacagggtggcgggtgactccttgtgacccgttattggcg
gagcgggccgcatggcacgagatcagcacactgagcgacgcgatccctgggccagtgatg
ttacgtggtgacgtgcatgtggatgttccggagaacctttatcttgacacctcggggtgg
ggtaagggggctgtgtgggttaatggcttcaatgtgggtcggtattggtcgcgtggcccg
caacacacgttgtttgttcctgctgaactgttgcgccccggggtgaactcaatcatggtc
ttcgaactttttggggtggcgagtgctcatgtggtgtgtgctgcgggcccggacttgggg
cacacggagttttag

DBGET integrated database retrieval system