KEGG   Jonesia denitrificans: Jden_0126Help
Entry
Jden_0126         CDS       T00972                                 

Definition
aldose 1-epimerase
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_0126
Enzymes [BR:jde01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     Jden_0126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(136859..137725)
Genome map
AA seq 288 aa AA seqDB search
MTTAHDTSPDNVLTPAGTFTVRTWGGHVTQWDAPGFGPLLYVSSAANHTPGVALRGGVPV
CFPWFAKGPDGSHSPSHGFARLSEWAHLSTTEDAQGNLTVTHELTPTQAAAADGIQLFPH
PFHATHTAEFTATTLTISLTVVNTGDNDFTFEEALHTYLAVSTITDVSVFGLDGEPFTED
GAAGTQEGPLTFGERIDRIYTSMHPVTLADPGANRTITITKTGSRSTVVWNPGPDLAATM
PDIGHGEWERFVCIESGNIGDNAITVKPGQGHTLTAKYEVSPIEPIEM
NT seq 867 nt NT seq  +upstreamnt  +downstreamnt
atgacgacagcgcatgacacaagccccgacaacgtcctcaccccagccggaactttcacc
gtccgcacctggggtggacacgtcacccaatgggacgctcccggctttgggccactgctg
tacgtctccagcgcagcgaaccacacccccggcgtcgctcttcgaggcggggtaccggtc
tgcttcccatggttcgccaaaggacctgacggcagtcactccccctcccacgggttcgca
cgactcagcgaatgggcacacctgtccaccactgaagacgcacaaggaaacctcaccgtc
acccacgaactcacccccacccaagcagccgccgcagacggcatccaacttttcccccac
cctttccacgccacccacaccgccgaattcaccgcaaccacactcaccatcagcttgacc
gtcgtcaacaccggagacaacgacttcacgttcgaagaagccctccacacctaccttgct
gtctccaccatcaccgacgtcagcgtctttggactcgacggtgagccgttcaccgaagac
ggcgccgctggcacccaagaaggaccactcaccttcggggagcgcatcgaccggatttac
acctccatgcaccccgtgaccctcgctgaccccggagcgaaccgcaccatcaccatcaca
aaaaccgggtcacgctccacggttgtgtggaacccaggaccggatctcgccgccaccatg
cctgacatcggtcacggcgaatgggagcgctttgtgtgcatcgaatcaggaaacattggg
gacaacgccatcaccgtcaaacccggccagggacacaccctcaccgcaaaatatgaggtc
tccccgatcgaaccaatcgagatgtga

DBGET integrated database retrieval system