KEGG   Jonesia denitrificans: Jden_0232Help
Entry
Jden_0232         CDS       T00972                                 

Definition
beta-N-acetylhexosaminidase (EC:3.2.1.52)
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
jde  Jonesia denitrificans
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    Jden_0232
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    Jden_0232
Enzymes [BR:jde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     Jden_0232
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(246333..247772)
Genome map
AA seq 479 aa AA seqDB search
MPVHIIPAPQHLTTTSTPLPHLTHDEYARLTAHLTSWAPHAAAHLTAVVSAHTDTLVSTS
TDHTPRTINTTLNTDLTAESFQLTATRDHIALTAADQAGAFYAINALIQALRTPGVEGFT
AHSTPTYPTRGVMLDLARHFFGVDTITSVIDVASAYGLNRLHLHLSDDQGWRIEIDGHPA
LTERASANDVDGGAGGYLTLADYEAIQEYAAAHAMIVVPEIDLPGHTHALQVAYPQVSPN
GKPREPYAGIDVGFSWVHLTADATWELLDDIVGSLARTTHGEYLHVGGDEVKQVSRPEYE
QFMGRLGELVAAHGKKLVVWQEAAGSPLPQGTQVQYWTHEFNQDNLAQLATHTGVEVIAS
PAYHTYLDLKPVPDFPLGLTWAGLVPLRAAYEWTPAAAMPVIPSRMITGVETCLWTETIR
TPHDIMTMLLPRLPAVASVAWGSPVDYPQFVHAIATHHHTWWHPNGWTHYPDPDVPWQQ
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgcccgtccacatcattcccgcaccccaacacctcaccaccaccagtacgccattaccc
cacctcacgcacgacgaatacgctaggctcaccgcgcatctgacatcgtgggcaccccac
gcagccgcccacctcactgctgtggtgtccgcgcacacggacactctggtcagcacgtca
acagaccacaccccccgcacgatcaacaccaccctcaacaccgacctcaccgcagaaagc
ttccagctcaccgccacacgcgaccacattgccctgaccgccgccgaccaagcaggagcc
ttctacgcaatcaacgcgctcatccaagcgttacgcaccccaggagtcgaaggattcacc
gcacacagcacccccacctaccccacacgtggggtgatgcttgacctcgcacggcacttt
ttcggcgtggacaccatcaccagtgttattgatgtggccagcgcttacgggctgaaccgc
ctccacctccacctcagcgacgaccaggggtggcgcatcgagattgacgggcacccggcg
ctcacggaacgggcatcagcgaacgatgtggacggcggggcgggcgggtacctcaccctc
gcggattacgaggcgatccaagagtacgctgcagcgcacgccatgattgtggtgcccgag
attgacctgccgggccacacgcatgccctgcaagtcgcctaccctcaggtgtcaccgaat
gggaaaccgcgtgaaccttatgcggggattgatgtggggttctcatgggtgcacctcacc
gctgacgccacctgggaactccttgatgacattgtgggcagcctggcgcgcaccacccac
ggcgaatacttgcacgtgggcggggatgaggtgaagcaggtttcccgccccgagtatgaa
cagttcatgggcaggctcggtgaactcgtcgcggcgcacggcaaaaaacttgtggtgtgg
caagaggcggcaggctcaccactaccgcagggcacccaagtgcagtactggacacacgag
ttcaaccaagacaacctggcacaactggccacacacaccggtgttgaggtgattgcgtca
ccggcttaccacacctaccttgacctgaaaccggtccctgactttccgttgggattaacg
tgggcggggctggtgccattacgagccgcatacgagtggacgcctgctgcggcgatgccg
gttatccccagtcgcatgatcacaggagtggaaacctgcctgtggacagaaacaatccgc
acaccccacgacatcatgacgatgctcctcccacgcctacccgcagtcgccagcgtcgca
tggggatcacccgtggactacccccaatttgtccacgccatcgccacccaccaccacacc
tggtggcaccccaacggctggacccactaccctgaccccgacgtcccctggcagcaatga

  All links  
No link information was found.   
DBGET integrated database retrieval system