KEGG   Jonesia denitrificans: Jden_0238Help
Entry
Jden_0238         CDS       T00972                                 

Definition
ROK family protein
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
jde  Jonesia denitrificans
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_0238
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Jden_0238
   00052 Galactose metabolism
    Jden_0238
   00500 Starch and sucrose metabolism
    Jden_0238
   00520 Amino sugar and nucleotide sugar metabolism
    Jden_0238
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Jden_0238
   00524 Butirosin and neomycin biosynthesis
    Jden_0238
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Jden_0238
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
252980..253951
Genome map
AA seq 323 aa AA seqDB search
MAEVVTDILVLALDIGGTNSRGEVLRWGSGTLSEPLAQASLPTPSGDGDGAVNTIITLCR
TLLGALDEPTRALVAGIGLGVPGVLDTDRGVVTLASNVGWVNRPICADIEAAVGLPVYLT
HDVTAAGAAEQRLGAGRGCDDVIAVFLGTGIAASITSGGHLVTGGVLPGGGRQPAGEIGH
LPVDVHGPLCSCGQRGCLELMSSARAIGRRYSVARGVDPDGPDALTSRDVVAALGTDPVA
KDVWDDATRYLAHGLLAVTIAVGATRIIMGGGLSQAGRVLTDSVRAHLVEQTRVASVPEI
VTAQLGQRAGVLGVALHALDQIV
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcagaagtggtaacggacattcttgtcctggcactcgatattggtggcaccaacagc
cgtggtgaagtgctgcgctggggttcagggactctgagtgaaccactcgcgcaggcgtcg
ttgccgaccccgtctggggacggcgacggggccgtgaacaccatcatcacgttgtgtcgc
acgttgctaggggcacttgacgaaccgactcgcgcgcttgttgcaggcatcgggttgggt
gttcctggcgtgctggacactgaccgtggtgtggtgacacttgcgtcaaacgtggggtgg
gtgaaccgacctatttgcgctgacattgaggcagcggtggggctcccggtgtatttaact
cacgatgtgaccgctgcgggtgcagcggagcaacgcttaggtgccgggcgtggttgtgat
gatgtcattgccgtgttcttaggaacaggtattgccgcgtccattacctctggtggtcat
ctggtcactgggggtgtgctccctggtgggggcaggcaaccagcaggggagatcgggcac
ctgcccgttgatgtgcatgggccgttgtgttcgtgtggtcagcgagggtgtttggagttg
atgagctccgcgcgtgccattggacgccggtacagtgttgcccgtggtgtcgacccggat
gggccagatgcgttgacgtcacgggatgtggtggctgcgttgggcaccgacccggtcgcg
aaagatgtgtgggacgatgccacccgctaccttgcgcacgggttgttggccgtgacaatt
gctgtgggggccacccggatcatcatggggggtggtttatcccaggcgggccgggtgctc
acagattcagtgcgtgcgcatttggtggagcagacacgggtcgcgtccgttccagagatt
gtgactgctcaactggggcaacgcgccggtgtgctcggggttgccctgcacgccttggac
cagattgtgtga

DBGET integrated database retrieval system