KEGG   Jonesia denitrificans: Jden_0311Help
Entry
Jden_0311         CDS       T00972                                 

Definition
beta-galactosidase (EC:3.2.1.23)
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
jde  Jonesia denitrificans
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:jde00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
331079..333214
Genome map
AA seq 711 aa AA seqDB search
MRFDPQFQPRDYGLRGLEAVTYGGDYNPEQWPRHVWREDVRLMREAGVNLVSIGIWSWAL
LEPEPGRFDFEWLDELIELLWANEIHVDLATPTAAPPAWFYANNPDARVVTRDGTVLTNA
SRGMASPSAPAYRQACASITEALAKRYGDHPAVALWHVHNEYGAPVSDSYDEYSVAAWRV
WLQRRYTTLDAVNEAWGTTFWGQTYTQWEHIPAPAVSATVTNPSMRLDYQRFTSDALLEC
FIAERDIIRQYSTAPVTTNFMASSCPAMDLWAWAQECDVISNDHYLTASDPNNHITLAMD
ADLTRSLARGLPWILMEHSTSAVNWQERNVAKAPGEMTRNALSHLGRGANGIMFFQWRAA
RFGAEKFHSAMIPHGGTNTRVFREVCSLGATLGDLTSQGITASTTRAQVAILWDWESMWA
QDLEWRPSVDVDHRERTVAFYQQLFHDRFTVDFVHPEAALDQYALVIAPASYLLTDAAAA
NIDAYVRGGGRFVASFFTGVVDDNDTVRHGGLAAALAPVLGVTVEEFLPLRAGETLTVHG
DQLAPGLTLTGDVWADDLVLDGAKDVASYVDGPAPGGPAITRHEYGQGVAWYVSTRLCGD
SLRAVLDAVYKDAGLTPERDVPHGLEIVVRTSDTGATFVTAMNHTDTDAGFPPVGGHGTL
QGVDLRGGRIVTPPVVARTHTTPTPTDAPVAVSTVSDTIMVPARGSVVVVK
NT seq 2136 nt NT seq  +upstreamnt  +downstreamnt
atgcgtttcgatccccagttccagccccgtgactacggccttcgtggtctggaagcggtc
acctatggtggcgactataacccggagcagtggccccggcacgtgtggcgtgaggatgtg
cgcctcatgcgggaagccggcgtcaacttggtgtccattgggatttggtcgtgggcattg
ctcgaaccagagccaggtcggttcgattttgagtggctcgatgaactgattgagctgcta
tgggccaatgagatccacgtggacctggccacaccgaccgccgcacccccagcatggttt
tacgccaacaaccctgatgcacgggtcgtgaccagggacggtactgtgctgaccaacgcg
tcacgcgggatggcctcaccctcagcgcccgcttaccggcaggcgtgcgcgtcaataact
gaagcgttagcgaaacggtacggggaccacccggcggtcgccttatggcacgtacacaac
gagtacggcgcgcctgtgtccgactcgtacgacgagtattcggtggcggcgtggcgggtg
tggcttcaacgccgctacaccacgttggacgcggtcaacgaggcatggggcaccacgttt
tgggggcaaacctacacacagtgggagcacatccctgcccctgctgtgtccgcaacggtg
acaaacccgtccatgcgcctggactaccagcggttcacttccgatgcgctgctggaatgc
ttcattgctgagcgcgatattatccgccagtactccaccgccccagtgaccacgaacttc
atggcatcctcatgcccagcaatggatctgtgggcgtgggcgcaagaatgcgacgtcatc
tccaatgaccactacttaacagctagtgaccccaacaaccacatcaccttggccatggac
gcagacctcacccgctcattggcgcgcggactgccatggatacttatggaacattccacc
tcggcggtgaactggcaggaacgcaacgtcgccaaagccccaggagagatgacccgcaac
gcactgtcccacctggggcgcggcgcaaacggcatcatgttcttccagtggcgggcagcc
cgctttggggcggaaaagttccactcagcgatgatcccgcacggcggcaccaacactcga
gtgttccgtgaggtgtgctcccttggagccacccttggagatctcaccagccaggggatc
accgcatcgacaacccgcgcgcaggtagcgatcctgtgggactgggaatccatgtgggcc
caagacctcgaatggcgcccttcggtggacgtcgaccaccgcgaacgtacggtggcgttt
taccaacagctattccacgaccggttcacggttgattttgtgcacccggaagcggcattg
gaccaatacgcgttggtgattgccccagcgtcgtacctgttaacggatgcggcagcagcg
aacattgatgcgtatgtgcggggcgggggcaggtttgttgcctcgttcttcaccggtgtt
gttgacgacaatgacacggtgcgtcatggcgggttggcagcggcgttggccccggttctt
ggggtgacggtggaggaattcctcccgttgcgggcaggggaaacgctgacagtgcacggc
gaccagttggcgccggggctgacattgactggcgatgtgtgggctgacgaccttgtgtta
gacggtgccaaagatgtggcgtcctacgtggatggtcccgcccctggcggaccagcgatc
acccgccatgaatatgggcaaggggtcgcctggtatgtgtcaactcggctgtgtggggac
agcttacgtgccgtgttggatgccgtgtacaaggatgcagggttaaccccagagcgtgac
gtgccgcacggccttgagatcgttgtgcgcaccagcgacaccggtgccacatttgtgaca
gcaatgaaccacacggacacagacgcagggttcccacctgttggagggcacggaacactg
cagggggtggacctgcgtggggggcgcatcgtcactccgccagttgttgcccgcactcac
accacccccacaccaaccgacgcacccgttgcggtgagcacagtgagtgacaccatcatg
gtgccagctcgaggcagcgtcgtggtggtgaagtag

DBGET integrated database retrieval system