KEGG   Jonesia denitrificans: Jden_0415Help
Entry
Jden_0415         CDS       T00972                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
jde  Jonesia denitrificans
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:jde03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
439532..440131
Genome map
AA seq 199 aa AA seqDB search
MYEGAVQDLIDELGRLPGVGPKSAQRIAFHILSADSDDIARLTQAIVEVKRRVRFCDECG
NVAEEERCRICRDPRRSAEVICVVEEAKDVVAIERTREFRGKYHVLGGAINPMDNVGPDD
LRISELMTRLADGTVTEIILAMDPNVEGEATATYLARLLGAIGIRVTRLASGLPVGGDLE
YADEVTLGRAFEGRRLMGN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgtacgaaggtgctgttcaagacctcatcgatgaattggggcgtctgccaggtgtggga
ccaaaaagtgcgcaacgcattgcgttccatatcctgtccgcagacagcgacgacatcgct
cgcctgacgcaagcaattgttgaggtcaaacgccgggtgcgtttctgcgacgaatgcgga
aacgttgccgaggaggaacggtgccgaatctgtcgtgacccacgtcgttccgctgaggtc
atctgtgtggtggaagaagcaaaagatgtggttgctattgaacggacccgcgagttccgc
ggaaaataccatgttcttgggggagcaattaaccccatggacaatgttgggccagatgac
ttacgcattagcgagctgatgactcgactcgctgacggtactgtcactgaaattatcctt
gccatggaccccaatgttgagggggaagcaacagcaacttaccttgcccggttgcttggt
gcgatcggtattcgtgtgacacggttggcttctgggctacccgttgggggagacttggaa
tacgccgatgaagtcaccctcgggcgggcttttgaaggccgacgtttgatgggcaactaa

DBGET integrated database retrieval system