KEGG   Jonesia denitrificans: Jden_0485Help
Entry
Jden_0485         CDS       T00972                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
jde  Jonesia denitrificans
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Jden_0485
Enzymes [BR:jde01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Jden_0485
Exosome [BR:jde04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Jden_0485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(524430..525947)
Genome map
AA seq 505 aa AA seqDB search
MTKKFVLAIDQGTTSSRAILFTHQGTIHSVGQLEHDQIFPQAGWVEHNADQIWNNVREVV
GLALTRGNATYDDVAAVGITNQRETAVVWDKNTGKPVYNAIVWQDTRTQKIVDELGGDEG
ADRYKKLTGLPLATYFSGPKVKWILDNVDGAREAADKGDLLFGTTDSWVLWNMTGGPNGG
VHVTDVTNASRTLLMNIETLQWDESMAEVMGIPMSMLPEIKSSSEVYGHGRKQGLVPGVP
ISGILGDQQAATFGQACFEVGTAKNTYGTGNFMLMNTGTEPIHSKNGLLTTVCYKIGDQP
AVYALEGSIAVTGSLIQWLRDNLGLFEDAQDVEYLARKVDDNGGAYVVPAFSGLFAPYWR
SDARGAIVGLTRYVNKNHIARAALESVAFQTREVVDAMNADSGVALTELKVDGGMVANEL
LMQFISDQLDVEVIRPEVAETTALGAAYAAGIAVGFWNGEDDVRNNWKEGKRWAPAEKQS
ERERQYRLWKKAVTKTFDWVDDDVK
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaccaagaaatttgttcttgccatcgaccaaggaacaacaagctcccgcgcaattttg
ttcacccatcagggcacgatccactcggttggccagttggagcacgaccagatcttcccg
caagcagggtgggtagagcacaacgccgaccaaatttggaacaacgtgcgcgaagtggtg
ggccttgctctcactcgcgggaacgccacctacgatgatgtcgctgctgtagggatcacc
aaccaacgtgaaacagctgtggtgtgggacaaaaacaccgggaaaccggtgtacaacgcc
attgtgtggcaagacactcgcacccaaaaaattgttgacgaactcggtggggacgaaggc
gcagaccggtacaagaaactcaccggtttgcctttggctacctacttctctgggccaaag
gtcaagtggatcctcgacaatgttgatggtgcccgggaagcagcggacaagggtgacctg
ttgtttgggaccactgactcgtgggtgctgtggaacatgacgggtggccccaacggtggt
gtccacgtcaccgatgtcaccaacgcgtcgcgtacactgttgatgaacattgaaaccctg
cagtgggatgaatccatggccgaggtcatggggatcccgatgtccatgctcccggaaatt
aagtcatcctccgaggtgtatgggcacggtcgtaagcaggggctggttcctggtgtgccc
atctcggggattctgggtgaccagcaggctgccacgtttgggcaggcgtgttttgaggta
ggcaccgcgaagaacacgtacggtactggcaacttcatgctcatgaacacaggtaccgaa
ccgatccactcgaagaatggtctgctcaccacggtgtgctacaagattggtgaccagccc
gccgtgtacgccttggaaggctccattgcggtcactgggtcattgattcagtggttgcgg
gacaacttgggtctgtttgaagatgcccaagatgtggagtacttggcacgcaaggttgat
gacaatggcggcgcctatgtggttcctgcgttctctggtttgtttgcgccctactggcgt
tccgatgcgcgtggcgcgattgtgggtctaacccgctacgtgaataagaaccacattgcc
cgtgcagctcttgagtcggtggcattccagacccgtgaggtcgttgatgccatgaacgct
gattctggtgtggcgttgactgagctcaaagtggacggcggcatggtcgctaatgaactg
ctcatgcagttcattagcgaccagcttgatgtggaggttattcgacctgaggtcgcggaa
actaccgcacttggtgccgcctacgcggctggtattgcggtgggtttctggaatggggaa
gacgacgtccgcaacaactggaaggaaggcaaacgctgggcccctgctgagaagcagtcc
gaacgtgagcgtcagtaccggttgtggaagaaagctgtaacaaagacgttcgactgggtt
gatgacgacgtgaagtag

DBGET integrated database retrieval system