KEGG   Jonesia denitrificans: Jden_0538Help
Entry
Jden_0538         CDS       T00972                                 

Definition
glycoside hydrolase family protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
jde  Jonesia denitrificans
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Jden_0538
Enzymes [BR:jde01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     Jden_0538
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(581860..583200)
Genome map
AA seq 446 aa AA seqDB search
MRQRTTSLLTTAALVGAGLIPAALLTAAPAHAAAGCTVDYSIASQWPGGFQGAVTVTNTG
DPINSWEITWNEPAGQSIAQAWNATVSQTGNTVTAGNVSWNGALGTNGSTSFGFIGQGSS
PTAPTAFTLNGVACSVDGSPVTPPDPEPTDPTDPVDPDPDPTDEPAPNPSALFLDTDTQA
YEAWQAASGSDKDLLAKIALTPAARWIGDWDSNSEVTEKVRQLTTDAHEAGKKAAFVAYA
IPGRDCGNHSSGGVATSEYANWINAVAQGIVGNPLIVLEPDALPQLGDCDGQGDRAGYLA
YAAQTLTNAGAEVYIDAGNSGWKTAEVMAERLQQAGIEHAAGFSLNVSNYHTTADSVAYG
QRISDLIGGKKFVVDTSRNGNGSNGEWCNPSGRALGEQPSLNASGAHRGNLWIKLPGESD
GSCNGGPAAGQWWQAGALELARNAKW
NT seq 1341 nt NT seq  +upstreamnt  +downstreamnt
atgagacagcgcacgacatcgctcctcaccacagcagcacttgtgggagcaggactcatc
ccagcagcactcctcactgccgcaccagcacatgccgcagcaggatgcacggtcgactac
agcatcgctagtcaatggcccggtggcttccagggggcagtcaccgtgacaaacacgggc
gaccccatcaactcctgggaaattacctggaacgaaccagccggccaaagcatcgcccag
gcgtggaacgccacggtctcccaaaccggaaacaccgtgacagcaggtaacgtctcctgg
aacggcgcgcttggtaccaacggaagcacaagcttcggattcatcggtcaaggttcctcc
cccacagcccccaccgccttcacgctcaacggcgtcgcgtgttccgtggacggctcccca
gtcacaccaccagaccccgagccaaccgacccaaccgacccagtcgacccagacccagac
cccaccgacgagccagccccaaaccccagtgcactattcctcgacactgacacccaggcc
tacgaggcatggcaagccgcaagcggatctgacaaagaccttctggcaaaaattgccctc
acccccgcagcacgatggattggcgactgggactccaactcagaagtcactgaaaaagtt
cgccaactcaccactgacgcacacgaagccgggaaaaaggcagccttcgtggcgtacgca
atccccggacgtgactgtggcaaccactcctcaggaggggtagccaccagcgaatacgcc
aactggatcaacgctgttgcccaagggatcgtggggaaccccctcattgtgctcgagccc
gacgcgctcccccaactcggtgactgcgatggccaaggcgaccgcgctggatacctcgcc
tacgcagcacaaacactgacaaacgcaggtgcagaggtttacatcgacgccggaaacagc
ggctggaaaacagcagaagtcatggcagaacgcctccagcaagcaggaatcgaacacgct
gcagggttctccctcaacgtctcgaactaccacaccaccgcagactccgttgcctacgga
cagcgcatctccgatctcatcggagggaaaaagttcgttgttgacacctcacgcaacggc
aacggatccaacggcgaatggtgcaacccctccggacgtgcactcggtgaacaaccatca
ctgaatgcttcgggtgcccaccgcggaaacttgtggatcaaactgcccggcgaatctgac
ggttcctgcaacggtggccccgcagcaggtcaatggtggcaggcaggcgcactagaactc
gcacgtaacgccaagtggtaa

DBGET integrated database retrieval system