KEGG   Jonesia denitrificans: Jden_0671Help
Entry
Jden_0671         CDS       T00972                                 

Definition
(RefSeq) succinyl-CoA synthetase, beta subunit (EC:6.2.1.5)
  KO
K01903  
succinyl-CoA synthetase beta subunit [EC:6.2.1.5]
Organism
jde  Jonesia denitrificans
Pathway
Citrate cycle (TCA cycle)
Propanoate metabolism
C5-Branched dibasic acid metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:jde00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Jden_0671
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Jden_0671
   00640 Propanoate metabolism
    Jden_0671
   00660 C5-Branched dibasic acid metabolism
    Jden_0671
Enzymes [BR:jde01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.5  succinate---CoA ligase (ADP-forming)
     Jden_0671
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
714380..715546
Genome map
AA seq 388 aa AA seqDB search
MDLFEYQARDIFEKHGVPVLGGVVATTPQEARNGAEQLGGGTVVVKAQVKTGGRGKAGGV
KLAHSPQEAHDRAQEILGMDIKGHTVHRVMIAQGASIDQEFYVSILLDRANRSYLAMASV
EGGMEIEQLAVERPEALARVAVDPTVGIDDAKAIEIAHAANFAPELTAKVVEVLKKLWVV
YRDEDATLVEVNPLVLTSDGDIVALDGKVSLDDNASFRHPDHGDLADSEATDPLEAKAQE
NDLNYVKLDGEVGVIGNGAGLVMSTLDVVAYAGERHGGVRPANFLDIGGGASASVMAAGL
DVILGDPQVKSVFVNVFGGITACDEVANGIVTALDILGDTATKPLVVRLDGNNVDEGRAI
LRAAAHPLVTLADTMDGGADRAAELANA
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
gtggacctgttcgaataccaagcacgcgacatattcgagaagcacggcgttcccgtgctc
ggcggcgtcgttgccactacaccacaagaagcacgcaacggagccgaacaactgggcggc
ggaacagtcgtcgtcaaagcccaagtgaaaaccggcggccgcggaaaagcgggcggcgtc
aagctggcacactcaccgcaagaagcacacgaccgcgcccaagagatccttggcatggat
atcaaagggcacaccgtccaccgggtcatgatcgcgcaaggcgcttcaatcgaccaagag
ttctacgtgtccattctgttggatcgagcaaaccgctcctacctggcaatggccagtgtg
gaaggcggcatggagatcgaacaactcgctgtcgaacgccccgaagcactcgcgcgcgtg
gccgttgaccccacagtgggcatcgatgacgccaaagcaatagaaatcgcacacgctgcg
aacttcgcccccgaactcaccgccaaagtcgtagaggtcctcaaaaagttgtgggtcgtt
taccgtgacgaagacgccacactcgtggaagtgaaccctctggttctgacatccgacggt
gacattgtggcactcgacgggaaagtctcactcgacgacaacgcctccttccgacaccca
gaccacggggaccttgcggactcagaagcaacagacccactagaagcaaaagcgcaagaa
aacgacctcaactacgtcaaacttgatggcgaagtaggagtcatcggtaacggtgctggg
cttgtcatgtcaaccctcgatgttgttgcttacgcaggagaacgccatggtggtgtccgc
cccgcaaacttccttgacatcggcggaggtgcatctgcgtccgtcatggccgccggcctc
gacgtcatcctcggtgacccccaggtcaagtcagtgttcgtcaatgtgttcggggggatc
accgcgtgtgacgaagtcgccaatgggatcgtcacagcccttgacatccttggcgacact
gcaaccaaaccgctcgttgtgcgactcgatggcaacaacgtcgacgaaggtcgagcaatt
ttgcgtgcagcagcccaccccctagtcacccttgccgacacgatggacggcggagcagac
cgcgctgccgaactcgccaacgcctga

DBGET integrated database retrieval system